KEGG   Escherichia coli UM146: UM146_02180
Entry
UM146_02180       CDS       T02000                                 

Definition
(GenBank) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
elu  Escherichia coli UM146
Pathway
elu00230  Purine metabolism
elu01100  Metabolic pathways
elu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UM146_02180
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ADN69863
Position
complement(459615..460094)
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggtggaaaactttctcatgttcaactggcttatgcgaaatccggcgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system