KEGG   Escherichia coli UM146: UM146_02455
Entry
UM146_02455       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB
Motif
Pfam: PGAP1 LCAT Abhydrolase_6
Other DBs
NCBI-ProteinID: ADN69912
Position
complement(526319..528088)
AA seq 589 aa
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWS
LPTSGPKERKRLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAV
RDILDNIEPEAKLFGSRKDRGWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQL
LDVPLGLEYGPDSLDEEYLEVIRLYQFPVHVVGYNWLGSNMLSAIRLQEQIKKIVGGYQK
RGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGVLPSIGAAATYTRMKRGTENP
ESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRDGSTLTLPKNL
PIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVN
PFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGR
LDLNEVGNIRTIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQI
VHKNILERLAVQVSHEAAYRNPVSQAFALRSIIKIAQEVKKDGKMSYSD
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgacatcgacgatgcatatggacagggccgataagaataaagttggcaccgttgaaatt
gaggatctacgggttattccggttatttttctgcccggagtcatgggttcaaaccttatg
gataagaaaggaaaatccatctggcgatatgatgactctatgagtctgatgggctggtca
ctacctacatcaggaccaaaagagaggaaaagattattgcatcctgacagggtggaggtc
gataatcgtgggagaattcccgcacctccggatgcccaagaaaaacttattcagttaggt
caacaatatccggaggacccatccgataaagaagcaatggataattacactcaggcagta
cgtgacattttggataatatagagccagaagcgaaattatttggttcaagaaaagatcgc
ggctggggagaggttgcaaatgctagctacggttcctttctcgatgtattacaaacagca
ttgtaccgggacaaacctacaaagaaaggtgagacgttaagtgcgacctaccagcaacta
ctcgatgtacctttgggtttggagtatggtcctgactcacttgatgaagagtatcttgaa
gtcataaggttgtatcaatttccggtccatgtcgttggctataactggcttggttctaat
atgctctcagcaatcagactacaagaacagatcaagaaaattgttggaggctatcaaaaa
cgaggaatgaaatgccataaagttattctggttacgcattcaatgggaggactagtggca
aggtacttttcagagtgtctttcggggaatacggatgtctacggtattgttcatggcgta
ttaccatcaattggtgctgcggcgacatatacccgaatgaaacgtggaactgaaaaccca
gagtcaaatccggaagggtatgttatcagtcatatcttaggtcgtaatgcagctgaaatg
gtagctgttttttcccagtcgccaggaccaatggaattactacccatgaatgattatggt
gaagagtggcttaatattgtcgatcgtgatggtagtacattaacgctccctaaaaatctt
cccattaaagaaggtattgcccccgaagaacgcacctacgctgaactttatctaaataga
gaaaattggtggaaattggtggatgagaatctattgaatccttttaatacttcattaaat
caaaagcaaattgatactgattggaatatatatgaaaatttaattactgagagtgtcaat
ccatttcataagcaaattgctggaaaatatcatatcaatacttactctttctatgggaga
gcgaaattgggagatattcctgaagcgcatttaacgcaggaaaatgttctttggaaaggc
tcattatcaatgggaaaaaaaagtgatatatctttagaaccaaaattcattgatggtcgt
cttgatttaaatgaagttggtaacattagaactattaaggatgaattttctcctgaagaa
caggcgtgggaaataaatactgacgacggtgatacatatgttaagataggacagcgtttt
acattacgagactcttgtgaaaacggggatggtacagtacctcttcgtgcaggacaaatc
gtacacaagaacatcctagagcgtttggctgtacaggtttctcacgaggctgcttatcga
aatcccgttagtcaggcatttgcattacgttctattataaaaatagctcaggaggtaaaa
aaggatggtaaaatgtcatactctgattaa

DBGET integrated database retrieval system