KEGG   Escherichia coli UM146: UM146_02480Help
Entry
UM146_02480       CDS       T02000                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
elu  Escherichia coli UM146
Pathway
elu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    UM146_02480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elu02044]
    UM146_02480
Secretion system [BR:elu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   UM146_02480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ADN69917
Position
complement(535651..536316)
Genome map
AA seq 221 aa AA seqDB search
MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVELVRERLKDAGFSRENV
EHITYAQCALLDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAGELLYERMKQVLQEPAP
AQAVLTCFHRVLLLGFRGRYQDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQH
PLLHSPFFWLVTLALLLAGVWWGLHHWLNVLVDELLPQSLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagatatggatatcaatatcgatgcgctgctgcgcgacacgtttctgacggtg
gtggaactgcgtcagggaaccaccgtgcgtcacggtatcgagctgtatcgccactgtcag
cggcaggtggaactggtccgcgaacgtctgaaagatgccggattcagtcgggagaacgtg
gagcacataacttacgcgcagtgcgccctgctggacgaaacggtgctcagccgtagtggc
atggacgacggtcaggccatctggatgaaaaacccactccagtcgcatttcttcaacacc
ctgcaggccggtgagctgctgtacgagcggatgaagcaggtgctacaggaacccgccccc
gcgcaggccgtgctgacctgctttcaccgtgtcctgctgctgggatttcgcgggcgttat
caggatccggcagccccggagcgcgaccagcttatttcgacgctcaacgggcaggtcgcg
ccatttggtgtgctgccggaaacggcggtactgaacgtgccgttatccacccgtcagcac
cctttgctgcattcgccatttttctggctggtaacactggcgctgctactggcgggcgtc
tggtgggggctacaccactggctgaatgtactggtggatgaactgctgccgcaaagcctg
cgttaa

DBGET integrated database retrieval system