KEGG   Escherichia coli UM146: UM146_05750Help
Entry
UM146_05750       CDS       T02000                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
elu  Escherichia coli UM146
Pathway
elu00020  Citrate cycle (TCA cycle)
elu00620  Pyruvate metabolism
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01120  Microbial metabolism in diverse environments
elu01130  Biosynthesis of antibiotics
elu01200  Carbon metabolism
Module
elu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UM146_05750
   00620 Pyruvate metabolism
    UM146_05750
Enzymes [BR:elu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     UM146_05750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ADN70555
Position
1199339..1200985
Genome map
AA seq 548 aa AA seqDB search
MKKVTAMLFSMAVGLNAVSMAAKAKASEEQETDVLLIGGGIMSATLGTYLRELEPEWSMT
MVERLEGVAQESSNGWNNAGTGHSALMELNYTPQNADGSISIEKAVAINEAFQISRQFWA
HQVERGVLRTPRSFINTVPHMSFVWGEDNVNFLRARYAALQQSSLFRGMRYSEDHAQIKE
WAPLVMEGRDPQQKVAATRTEIGTDVNYGEITRQLIASLQKKSNFSLQLSSEVRALKRND
DNTWTVTVADLKNGTAQNIRAKFVFIGAGGAALKLLQESGIPEAKDYAGFPVGGQFLVSE
NPDVVNHHLAKVYGKASVGAPPMSVPHIDTRVLDGKRVVLFGPFATFSTKFLKNGSLWDL
MSSTTTSNVMPMMHVGLDNFDLVKYLVSQVMLSEEDRFEALKEYYPQAKKEDWRLWQAGQ
RVQIIKRDADKGGVLRLGTEVVSDQQGTIAALLGASPGASTAAPIMLNLLEKVFGDRVSS
PQWQATLKAIVPSYGRKLNGDVAATERELQYTSEVLGLKYDKPQAADSTPKPQLKPQPVQ
KEVADIAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgactgccatgctcttctcgatggccgtggggcttaatgccgtttcgatg
gcggcaaaagcgaaagcgtccgaggagcaggaaactgatgtactgttgattggcggcggc
attatgagcgccacgttggggacctatttacgcgagctggagcctgaatggtcgatgacc
atggtggagcgcctggagggtgtcgcgcaggagagttcgaacggctggaacaacgccgga
accgggcattctgcactgatggaactgaactacaccccgcaaaacgccgatggcagcatc
agtattgaaaaagcagtcgccattaacgaagcatttcagatttcgcgccagttctgggcg
caccaggtcgagcgcggcgtgctgcgtacaccgcgttcatttatcaataccgttccgcat
atgagctttgtctggggcgaggataatgttaatttcctgcgagcccgttacgccgcgttg
caacaaagctcgctgtttcgcggtatgcgttactctgaagatcacgcgcagatcaaagag
tgggcaccgttagtgatggaagggcgcgatccgcaacagaaagtggcagccacgcgtacg
gaaattggcactgatgtgaactatggcgagatcacccgccagttaattgcttccttgcag
aagaaatctaatttttcgctgcaactcagcagcgaagtccgcgccctaaagcgtaatgac
gataacacctggaccgttaccgttgccgatctgaaaaatggcactgcacagaacatccgc
gccaaatttgtctttatcggcgcgggcggtgcggcgctgaagctgttacaggaatcgggg
attccggaagcgaaagactacgccggtttcccggtgggcggacagttccttgtttcggaa
aatccggacgtggttaatcaccatctggcgaaggtttacggtaaagcatccgttggcgca
ccgccgatgtcggttccgcatatcgatacccgtgtgctggacggtaaacgcgtcgtgttg
tttgggccatttgccaccttctcaactaaattcctcaaaaacggttcattgtgggatctg
atgagttccaccaccacctctaacgtgatgccgatgatgcacgtcgggctggataatttc
gatctggtgaaatatctggtgagtcaggtgatgttgagtgaagaggatcgttttgaagcg
ttgaaagagtactatccgcaggcgaaaaaagaggactggcgtttgtggcaagcggggcag
cgcgtgcagattatcaagcgtgatgccgataaaggtggcgtactgcgtctcggtactgaa
gtggtcagtgaccagcaagggaccattgccgcgctgctgggggcatcgccaggtgcgtca
accgccgcgccgattatgttgaatctgctggaaaaagtatttggcgatcgcgtttccagc
ccgcaatggcaggcaacgttgaaggcgatcgttccgtcttatggacgcaagctgaacggt
gatgtagcggcaacagaacgcgagttgcagtacaccagcgaagtgctggggctgaaatac
gacaagccgcaggcagcagatagtacgccgaaaccgcagttgaaaccgcaacccgttcaa
aaagaagtggcggatattgcgttgtaa

DBGET integrated database retrieval system