KEGG   Escherichia coli UM146: UM146_07410Help
Entry
UM146_07410       CDS       T02000                                 

Definition
(GenBank) putative diguanylate cyclase
  KO
K21085  diguanylate cyclase [EC:2.7.7.65]
Organism
elu  Escherichia coli UM146
Pathway
elu02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:elu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    UM146_07410
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     UM146_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHASE7 GGDEF dCache_1 RRM_2 UDPGP
Motif
Other DBs
NCBI-ProteinID: ADN70873
Position
1589196..1590872
Genome map
AA seq 558 aa AA seqDB search
MENQSWLKKLARRLGPGHIVNLCFIVVLLFSTLLTWREVVVLEDAYISSQRNHLENVANA
LDKHLQYNVDKLIFLRNGMREALVAPLDFTSLRNAVTEFEQHRDEHAWQIELNRRRTLPV
NGVSDALVSEGNLLSRENESLDNEITAALEVGYLLRLAHNSSSMVEQAMYVSRAGFYVST
QPTLFTRNVPTRYYGYVTQPWFIGHSQRENRHRAVRWFTSQPEHASNTEPQVTVSVPVDS
NNYWYGVLGMSIPVRTMQQFLRNAIDKNLDGEYQLYDSKLRFLTSSNPDHPTGNIFDPRE
LALLAQAMEHDTRGGIRMNSRYVSWERLDHFDGVLVRVHTLSEGVRGDFGSISIALTLLW
ALFTTMLLISWYVIRRMVSNMYVLQSSLQWQAWHDTLTRLYNRGALFEKARPLAKLCQTH
QHPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSLRAQDVAGRVGGEEFCVILP
GASLTQAAEVAERIRLKLNEKEMLIAKSTTIRISASLGVSSSEETGDYDFEQLQSLADRR
LYLAKQAGRNRVCASDNA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccagagctggttgaaaaaactcgcacgccgcctggggcctggtcatatcgtt
aatctctgctttatcgtggtattgcttttttccaccttgctcacctggcgtgaagtggtg
gtgctggaagatgcctatatctccagccagcgtaatcatctggaaaacgtagccaacgcg
ctcgataagcatttgcagtataacgtcgacaaactgatctttttgcgtaatggcatgcgc
gaagctctcgtggcgccactggatttcacctctctgcgtaatgccgtaaccgagttcgaa
cagcatcgcgacgagcacgcctggcaaatcgaactcaaccgacggcgcaccctgccagtc
aatggcgtatcggatgcattagtcagcgaggggaatctcctgtctcgcgaaaatgaaagc
ctcgacaatgaaattaccgctgcactggaagttggttacttgctgcgactggcgcacaac
tcctcgtcgatggttgaacaggcgatgtatgtctcgcgtgctggattttacgtttcgacg
cagccgaccttgtttacgcgcaatgtaccaacgcgttattacggctatgtcacccaaccc
tggtttatcggccattcgcaacgagaaaatcgtcaccgcgcggtacgctggttcacttcg
caaccggaacacgccagcaatactgaaccgcaggttaccgtcagtgttccggtagacagt
aataactactggtatggcgtgctggggatgagtattcccgtgcgtactatgcagcaattt
ttaagaaacgccatcgataaaaacctcgatggtgagtatcagctctatgacagtaagctg
agatttttgacctcttccaatcctgaccatccaacagggaatatttttgatcctcgtgaa
ctggccttgctggcgcaggcaatggaacatgacacgcggggcggcattcgtatgaacagt
cgttatgttagctgggaacgtctggaccatttcgacggtgtgctggtgcgcgtccatacg
ctaagcgaaggcgtgcgtggtgatttcggcagtatcagcattgcattaactctgctgtgg
gcgctctttaccaccatgttactcatctcctggtatgtgattcgccggatggttagcaac
atgtatgttttgcaaagctcgttgcagtggcaggcgtggcacgacaccttaacgcgttta
tataaccgtggcgcactgttcgaaaaagcccgtccgctcgctaaattgtgtcagacgcac
caacatcctttttctgtcattcaggtcgaccttgaccattttaaagcgattaatgaccgc
tttggtcatcaggcgggcgaccgtgttctttctcatgctgccggattaattagcagttcc
ttgcgtgcgcaggacgttgccgggcgggtcggtggtgaggagttttgtgtgattctgccc
ggcgcgagtctgacgcaggctgcggaggttgcagaacgtattcgcctgaagctaaatgaa
aaagagatgttgatcgccaagagtacgacgatacgcattagtgcctcgctgggggtaagc
agcagcgaggaaaccggtgattatgattttgaacaactccagtcactggccgaccgtcgg
ctttatctcgctaaacaggccgggcgcaatcgggtatgcgcgagcgataacgcttaa

DBGET integrated database retrieval system