KEGG   Escherichia coli UM146: UM146_07425Help
Entry
UM146_07425       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DSRB
Motif
Other DBs
NCBI-ProteinID: ADN70876
Position
1592372..1592560
Genome map
AA seq 62 aa AA seqDB search
MKVNDRVTVKTDGGPRRPGVVLAVEEFSEGTMYLVSLEDYPLGIWFFNEAGHQDGIFVEK
AE
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgaatgatcgggtaacagtcaaaacggatggcggtccgcgtcgtcctggcgtg
gtactggcagttgaggagtttagtgaaggcacaatgtacctggtttcgctggaagactac
ccgctcggcatctggttctttaatgaagcagggcatcaggacggtatctttgtggagaaa
gcagagtaa

DBGET integrated database retrieval system