KEGG   Escherichia coli UM146: UM146_07465Help
Entry
UM146_07465       CDS       T02000                                 

Gene name
fliL
Definition
(GenBank) flagellar basal body-associated protein FliL
  KO
K02415  flagellar FliL protein
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:elu02035]
    UM146_07465 (fliL)
Bacterial motility proteins [BR:elu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    UM146_07465 (fliL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliL TPR_21 LPAM_1
Motif
Other DBs
NCBI-ProteinID: ADN70884
Position
complement(1597114..1597578)
Genome map
AA seq 154 aa AA seqDB search
MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQRVVPSPVFYALD
TFTVNLGDADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKK
NLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFILR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgactgattacgcgataagcaagaaaagcaagcgatcgctttggatcccgattctggta
ttcattaccctcgcggcctgtgccagcgcaggttacagctactggcattcgcatcaggtt
gccgctgacgacaaagcgcagcaacgcgtcgtgccctccccggtcttctatgcgctggat
acctttacggtcaatttgggcgatgcggatcgcgtgctttatatcggcataaccctgcga
ctgaaagatgaagctacccgctcgcggctgagtgagtatttgccggaagtccgtagccgt
ttgctgttactgttttcgcgtcaggatgctgccgtactggcgacagaagaaggcaagaaa
aacctgattgccgagattaaaaccacactttccaccccgcttgttgccgggcaaccgaaa
caggatgtcaccgacgtgctgtataccgcttttattctgcgataa

DBGET integrated database retrieval system