KEGG   Escherichia coli UM146: UM146_07485Help
Entry
UM146_07485       CDS       T02000                                 

Gene name
fliH
Definition
(GenBank) flagellar assembly protein H
  KO
K02411  flagellar assembly protein FliH
Organism
elu  Escherichia coli UM146
Pathway
elu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:elu00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    UM146_07485 (fliH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elu02044]
    UM146_07485 (fliH)
   02035 Bacterial motility proteins [BR:elu02035]
    UM146_07485 (fliH)
Secretion system [BR:elu02044]
 Type III secretion system
  Flagellar export apparatus
   UM146_07485 (fliH)
Bacterial motility proteins [BR:elu02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    UM146_07485 (fliH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliH Yae1_N NolV
Motif
Other DBs
NCBI-ProteinID: ADN70888
Position
complement(1600642..1601328)
Genome map
AA seq 228 aa AA seqDB search
MSDNLPWKTWMPDDLAPPQAEFVPMVEPEETIIEEAEPSLEQQLAQLQMQAHEQGYQAGI
AEGRQQGHEQGYQEGLAQGLEQGLAEAKSQQAPIHARMQQLVSEFQTTLDALDSVIASRL
MQMALEAARQVIGQTPTVDNSALIKQIQQLLQQEPLFSGKPQLRVHPDDLQRVDDMLGAT
LSLHGWRLRGDPTLHPGGCKVSADEGDLDASVATRWQELCRLAAPGVV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataatctgccgtggaaaacctggatgccggacgatctcgcgccaccacaggcg
gagtttgtgccaatggtcgagccggaagaaaccatcattgaagaggccgaacccagcctt
gagcagcaactggcgcaactgcaaatgcaggcccacgagcaaggttatcaggcggggatt
gccgaaggtcgccagcaaggtcatgagcagggctatcaggaaggcctggcccaggggctg
gaacaaggtctggcagaggcgaagtctcaacaagcgccaattcatgcccggatgcagcaa
ctggtcagcgaatttcaaactacccttgatgcgcttgatagtgtgattgcttcgcgcctg
atgcagatggcgctggaggcggcacgccaggtgatcggtcagacgccaacggtggacaac
tcggcactgatcaaacagatccaacagttgttgcagcaagaaccgttgttcagcggtaaa
ccgcagctgcgcgtgcaccccgatgatctgcaacgtgttgatgatatgctcggcgcaact
ttaagtttgcatggctggcgcttgcggggcgatcccaccctccatcctggcggctgtaaa
gtctccgccgatgaaggcgatctcgacgccagtgtcgccacccgctggcaagaactctgc
cgtctggcagcaccaggagtggtgtaa

DBGET integrated database retrieval system