KEGG   Escherichia coli UM146: UM146_07500Help
Entry
UM146_07500       CDS       T02000                                 

Gene name
fliE
Definition
(GenBank) flagellar hook-basal body protein FliE
  KO
K02408  flagellar hook-basal body complex protein FliE
Organism
elu  Escherichia coli UM146
Pathway
elu02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:elu00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    UM146_07500 (fliE)
Bacterial motility proteins [BR:elu02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    UM146_07500 (fliE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FliE
Motif
Other DBs
NCBI-ProteinID: ADN70891
Position
1604182..1604496
Genome map
AA seq 104 aa AA seqDB search
MSAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDRISDTQTVARTQAEKFT
LGEPGVALNDVMTDMQKASVSMQMGIQVRNKLVAAYQEVMSMQV
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgatacaggggattgaaggggttatcagccagttacaggctacggcgatgagt
gcgcgtgcgcaggaatcactgccgcaaccgaccattagttttgccgggcagctgcacgcc
gcgctcgatcgcataagcgatacacaaacagtcgcccgcacgcaggcagaaaaattcacc
ctcggtgaacccggcgtggcgctaaacgatgtgatgaccgatatgcaaaaagcctcagtt
tctatgcaaatggggattcaggtgcgtaataagctggtggcggcgtatcaggaagtgatg
tccatgcaggtgtag

DBGET integrated database retrieval system