KEGG   Escherichia coli UM146: UM146_07520Help
Entry
UM146_07520       CDS       T02000                                 

Definition
(GenBank) outer membrane porin; DLP12 prophage
  KO
K16076  outer membrane porin protein LC
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elu02000]
    UM146_07520
Transporters [BR:elu02000]
 Other Transporters
  Pores ion channels [TC:1]
   UM146_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_1 Porin_4
Motif
Other DBs
NCBI-ProteinID: ADN70895
Position
complement(1607201..1608283)
Genome map
AA seq 360 aa AA seqDB search
MKKLTVAISAVAASVLMAMSAQAAEIYNKDSNKLDLYGKVNAKHYFSSNDADDGDTTYVR
LGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAGLKFGDYGSIDYGRNYG
VAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNNDFFGLVDGLNFAAQYQGKND
RTDVTEANGDGFGFSTTYEYEGFGVGATYAKSDRTNDQVIYGNNSLNASGQNAEVWAAGL
KYDANNIYLATTYSETQNMTVFGNNHIANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDL
GAWGDQDLVEYIDVGATYYFNKNMSTFVDYKINLIDKSDFTKASGVATDDIVAVGLVYQF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaacagtggcaatttctgctgtagctgcatcagtactgatggcgatgtct
gctcaggcagcagagatttacaataaagacagtaacaagctggatctgtacggaaaagtt
aatgctaagcactacttctcttctaacgatgcagatgatggcgacacaacttatgttcgt
ctgggcttcaaaggcgaaactcaaatcaacgatcaactgactggtttcggtcagtgggaa
tatgaattcaaaggcaaccgtgctgaatctcaaggttcttccaaagataaaacccgtctt
gccttcgctggcctgaaattcggtgactacggctccatcgattatggccgtaactacggt
gtagcatacgatatcggtgcatggaccgacgttctgccagaattcggtggcgatacctgg
acccaaacagatgtgttcatgactggtcgcaccacaggtgttgcaacctatcgtaacaac
gacttctttggtctggttgatggtctgaactttgctgctcagtatcagggtaaaaatgac
cgcactgacgtaactgaagctaacggtgatggtttcggtttctccactacttatgagtat
gaaggattcggtgtaggtgcaacctatgctaaatctgaccgcactaatgatcaggttatc
tacggtaacaacagcctgaatgcatctggtcaaaatgctgaagtatgggcagctggtctg
aaatatgatgcgaacaacatctatctggctaccacctattctgaaacccagaacatgact
gtttttggtaataaccatattgccaacaaagcacaaaacttcgaagtagttgcacaatat
cagttcgacttcggtctgcgtccgtccgttgcttacctgcaatctaaaggaaaagacttg
ggtgcgtggggtgatcaggacctggttgaatatattgatgtaggtgcaacctattacttc
aacaaaaatatgtccacttttgttgattacaaaatcaacctgattgataagagcgatttc
acgaaagcatctggcgttgctaccgatgatatcgttgctgtaggattggtttaccagttc
taa

DBGET integrated database retrieval system