KEGG   Escherichia coli UM146: UM146_07535Help
Entry
UM146_07535       CDS       T02000                                 

Definition
(GenBank) putative inner membrane protein
  KO
K07112  uncharacterized protein
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    UM146_07535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulf_transp DUF4073
Motif
Other DBs
NCBI-ProteinID: ADN70898
Position
complement(1609802..1611007)
Genome map
AA seq 401 aa AA seqDB search
MSWQQFKHAWLIKFWAPIPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLFGVHA
EEWGYFKIIHLEGSPLTRIDGMMILGMFGGCFAAALWANNVKLRMPRSRIRIMQAIIGGI
IAGFGARLAMGCNLAAFFTGIPQFSLHAWFFAIATAIGSWFGARFTLLPIFRIPVKMQKV
SAASPLTQKPDQARRRFRLGMLVFFGMLGWALLTAMNQPKLGLAMLFGVGFGLLIERAQI
CFTSAFRDMWITGRTHMAKAIIIGMAVSAIGIFSYVQLGVEPKIMWAGPNAVIGGLLFGF
GIVLAGGCETGWMYRAVEGQVHYWWVGLGNVIGSTILAYYWDDFAPALATDWDKINLLKT
FGPMGGLLVTYLLLFAALMLIIGWEKRFFRRAAPQIAKEIA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggcagcaattcaaacacgcctggttgattaaattctgggcacccatccctgcg
gtcatcgcggcgggtattctctccacttactattttggcatcactggcacattttgggca
gtcacgggtgaatttacccgttggggcggtcagctcctgcagttgttcggcgtccatgct
gaagagtggggttattttaaaattatccatctggaaggatcgccattaacccgcatcgac
ggaatgatgatcctcggtatgtttggcggctgttttgccgcagcgctgtgggccaacaat
gtcaaactgcgcatgccgcgcagccgtatccgcattatgcaggccatcattggcggtatt
atcgccggttttggcgcacgtctggcaatgggctgtaacctggcggcgttctttaccgga
attccacagttctcgctgcacgcctggttctttgccatcgccactgccattggttcatgg
tttggcgcgcgctttaccctgctgcccatcttccgtattcccgtgaaaatgcagaaagtt
tctgccgcctcaccgctgacgcaaaaaccggatcaggcgcggcgtcgttttcgtctcggg
atgctggtctttttcggcatgctgggctgggcgctgctcacggcgatgaaccaacccaaa
ctggggctggcaatgctgtttggcgtcggctttggtttactgattgaacgtgcgcaaatc
tgctttacttcggcgttccgcgatatgtggatcaccggacgtacccatatggcgaaagca
atcattatcggtatggcggtaagtgccatcgggatcttcagttacgtacagttaggcgtt
gaacccaaaatcatgtgggcgggaccaaacgcggtaattggtggtttactgtttggtttt
ggcatcgtgctggcaggcggctgcgaaaccggctggatgtaccgcgcggtagaaggccag
gtgcactactggtgggtcggtctgggcaacgtgatcggctcaacgattctggcgtattac
tgggatgatttcgctccggcgctggccaccgactgggacaaaatcaacctgctgaaaacc
tttggtccgatgggtggcctgctggtgacatatttgctgttgtttgcagctctaatgttg
attatcggctgggaaaaacgcttcttccgccgtgcggcaccgcagattgctaaggagatc
gcatga

DBGET integrated database retrieval system