KEGG   Escherichia coli UM146: UM146_07540Help
Entry
UM146_07540       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YedD
Motif
Other DBs
NCBI-ProteinID: ADN70899
Position
1611194..1611607
Genome map
AA seq 137 aa AA seqDB search
MKKLAIAGALMLLAGCAEVENYNNVVKTPAPDWLTGYWQTKGPQRALVSPEAIGSLIVTK
EGDTLDCRQWQRVIAVPGKLTLMSDDLTNVTVKRELYEVERDGNTIEYDGMTMERVDRPT
AECAAALDKAPLPTPLP
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcgcaattgcaggtgcgctcatgttgctggcgggctgtgccgaagtcgaa
aactataacaatgtcgtgaaaacccccgcgccggactggctgacgggttactggcagacc
aaagggccgcaacgtgcgctggtcagtccggaagcgataggcagcctcattgtcactaaa
gagggcgataccctggattgccgtcagtggcagcgggtgattgccgtgccgggtaagttg
acattgatgtctgatgatctcactaacgttaccgtaaaacgtgagctgtacgaggttgag
cgtgacggtaacaccattgagtacgatggtatgacgatggagcgtgtggatcgcccgacg
gcagagtgtgccgccgcgctggataaagcgccgttaccgacgccactgccgtaa

DBGET integrated database retrieval system