KEGG   Escherichia coli UM146: UM146_07580Help
Entry
UM146_07580       CDS       T02000                                 

Definition
(GenBank) cystine transporter subunit
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
elu  Escherichia coli UM146
Pathway
elu02010  ABC transporters
Module
elu_M00234  Cystine transport system
Brite
KEGG Orthology (KO) [BR:elu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    UM146_07580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elu02000]
    UM146_07580
   02035 Bacterial motility proteins [BR:elu02035]
    UM146_07580
Transporters [BR:elu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    UM146_07580
Bacterial motility proteins [BR:elu02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    UM146_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1
Motif
Other DBs
NCBI-ProteinID: ADN70907
Position
1619158..1619958
Genome map
AA seq 266 aa AA seqDB search
MKLAHLGRQALMGVMAVALVAGMSVKSFADEGLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDF
STPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVN
DAIAEMQKDGTLQALSEKWFGADVTK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacatctgggacgtcaggcattgatgggtgtgatggccgtggcgctggtt
gcgggtatgagcgttaaaagttttgcagatgaaggtctgcttaataaagtcaaagagcgc
ggcacgctgctggtagggctggaaggaacttatccgccgttcagttttcagggggatgac
ggcaaattaaccggttttgaagtggaatttgcccaacagctggcaaaacatcttggcgtt
gaggcgtcactaaaaccgactaaatgggacggtatgctggcgtcgctggactctaaacgc
attgatgtggtgattaaccaggtcaccatttctgacgagcgcaagaaaaaatacgatttc
tctaccccgtacaccatttccggtattcaggcgctggtgaaaaaaggtaacgaaggcacc
attaaaacggctgatgatctgaaaggcaaaaaagtgggtgtcggtctgggcaccaactat
gaagagtggctgcgtcagaatgttcagggcgtggatgtgcgtacctatgatgatgacccg
accaaatatcaggatctgcgcgtaggccgtattgatgcgatcctcgttgatcgtctggcg
gcgctggatctggtgaagaaaaccaacgatacgctggcagtaaccggtgaagcattctcc
cgtcaggagtctggcgtggcgctgcgtaaaggaaatgaagacctgctgaaagcggtgaat
gatgcaattgcggaaatgcaaaaagatggcactttgcaagccctttccgaaaaatggttt
ggtgctgatgtgaccaaataa

DBGET integrated database retrieval system