KEGG   Escherichia coli UM146: UM146_07595Help
Entry
UM146_07595       CDS       T02000                                 

Definition
(GenBank) putative amino-acid ABC transporter ATP-binding protein YecC
  KO
K10010  cystine transport system ATP-binding protein [EC:3.6.3.-]
Organism
elu  Escherichia coli UM146
Pathway
elu02010  ABC transporters
Module
elu_M00234  Cystine transport system
Brite
KEGG Orthology (KO) [BR:elu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    UM146_07595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elu02000]
    UM146_07595
Enzymes [BR:elu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     UM146_07595
Transporters [BR:elu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter [MD:M00234] [OT]
    UM146_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_16 AAA_29 ABC_ATPase AAA_13 AAA_33 AAA_15 AAA_23 ATPase_2 AAA_30 AAA_24 cobW NACHT AAA_28 AAA RsgA_GTPase AAA_25 AAA_17 G-alpha NB-ARC AAA_14 AAA_18 T2SSE PduV-EutP AAA_7 SbcCD_C AAA_19 MobB PRK Pox_A32 AAA_35 AAA_5 MMR_HSR1 Roc ATP_bind_1 Rad17
Motif
Other DBs
NCBI-ProteinID: ADN70910
Position
1621729..1622481
Genome map
AA seq 250 aa AA seqDB search
MSAIEVKNLVKKFHGQTVLHGIDLEVKPGEVVAIIGPSGSGKTTLLRSINLLEQPEAGTI
TVGDITIDTARSLSQQKSLIRQLRQHVGFVFQNFNLFPHRTVLENIIEGPVIVKGEPKEE
ATARARELLAKVGLAGKETSYPRRLSGGQQQRVAIARALAMRPEVILFDEPTSALDPELV
GEVLNTIRQLAQEKRTMVIVTHEMSFARDVADRAIFMDQGRIVEQGVAKALFADPQQPRT
RQFMEKFLLQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccattgaagttaagaacctggtgaaaaaattccacggtcagacggtgctgcat
ggtatcgaccttgaggtgaagcctggcgaagtagtggctattatcggtccgagtggttcc
ggcaaaaccacgttgctacgcagcataaatctgctggaacaaccggaagcgggaaccatc
accgttggcgatatcactattgatactgcacgttcattaagtcagcaaaaatcgctgatt
cgccagttgcgtcagcacgtcgggtttgtcttccagaactttaatctgtttccgcatcgt
acggtgctggaaaacattattgaagggccggtgatcgtcaaaggcgaaccgaaagaagag
gccacggcgcgcgctcgcgagctgctggcgaaagttgggctggccggtaaagaaaccagt
tatccacgtcgtttgtctggcggtcaacagcagcgcgttgcgattgcgcgtgctctggca
atgcgtcctgaagtgattttgtttgatgagccaacgtcggcgctggatccagagctggtg
ggcgaagtcctgaacaccattcgtcagctggcgcaggaaaagcgcacgatggtgattgtg
acgcacgaaatgagctttgcccgggatgttgcggaccgggcgatttttatggaccagggg
cggatagtcgagcagggggtagcaaaagcgttatttgctgatcctcagcagcctcgcacc
cgccagttcatggagaagtttctgctgcaataa

DBGET integrated database retrieval system