KEGG   Escherichia coli UM146: UM146_07635Help
Entry
UM146_07635       CDS       T02000                                 

Definition
(GenBank) tyrosine-specific transport protein
  KO
K03834  tyrosine-specific transport protein
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elu02000]
    UM146_07635
Transporters [BR:elu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   UM146_07635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_Tyr_perm Aa_trans AA_permease_2
Motif
Other DBs
NCBI-ProteinID: ADN70918
Position
complement(1629373..1629849)
Genome map
AA seq 158 aa AA seqDB search
MKNRTLGSVFIVAGTTIGAGMLAMPLAAAGVGFSVTLILLIGLWALMCYTALLLLEVYQH
VPADTGLGTLAKRYLGRYGQWLTGFSMMFLMYALTAAYISGAGELLASSISDWTGISMSA
TAGVLLFTFVAGGVVCVGTSLVDLFNRFLFSAKIIFWW
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacagaactctgggaagtgtttttatcgtggcgggaaccacaattggcgctggt
atgctggcaatgccgctggctgcggcaggtgttggttttagcgtcacgttaatcttgtta
attgggctttgggcattgatgtgctacacggcgctattactgctggaggtgtaccagcat
gtcccggcagataccggtctgggcacgctggcaaaacgctatctgggacgctacggtcag
tggctgacgggcttcagtatgatgttcttaatgtatgctctgactgcggcatacatcagc
ggtgccggtgaattgttggcctccagcatcagcgactggacaggtatttcaatgtcggca
accgctggcgtgctgttgttcacttttgttgccggtggcgtggtttgtgtcggaacttcg
ctggtcgatttatttaaccgttttctgttcagcgccaaaattattttttggtggtga

DBGET integrated database retrieval system