KEGG   Escherichia coli UM146: UM146_07745Help
Entry
UM146_07745       CDS       T02000                                 

Definition
(GenBank) chemotaxis regulator CheZ
  KO
K03414  chemotaxis protein CheZ
Organism
elu  Escherichia coli UM146
Pathway
elu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:elu00001]
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    UM146_07745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:elu02035]
    UM146_07745
Bacterial motility proteins [BR:elu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    UM146_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheZ
Motif
Other DBs
NCBI-ProteinID: ADN70940
Structure
PDB: 

Position
1650342..1650986
Genome map
AA seq 214 aa AA seqDB search
MMQPSIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQ
MTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLAD
VPAHTSFTNAQLLEIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLENIPEQESRPKR
ENQSLLNGPQVDTSKAGVVASQDQVDDLLDSLGF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaccatcaatcaaacctgctgacgagcattcagctggcgatatcattgcgcgc
atcggcagcctgacgcgtatgctgcgcgacagtttgcgggagctggggctggatcaggcc
attgccgaagcagcggaagccatccccgatgcgcgcgatcgtttgtactatgttgtgcag
atgaccgcccaggctgcggagcgggcgctgaacagtgttgaggcgtcacaaccgcatcag
gatcaaatggagaaatcagcaaaagcgttaacccaacgttgggatgactggtttgccgat
ccgattgaccttgccgacgcccgtgaactggtaacagacacgcggcaatttctggcagat
gtccccgcgcataccagctttactaacgcgcaactgctggaaatcatgatggcgcaggat
tttcaggatctcaccggacaggtcattaagcggatgatggatgtcattcaggagatcgaa
cgtcagttgctgatggtgctgttggaaaacatcccggaacaggagtcgcgtccaaaacgt
gaaaaccagagtttgcttaatggacctcaggtcgataccagcaaagccggtgtggtagcc
agtcaggatcaggtggacgatttgttggatagtcttggattttga

DBGET integrated database retrieval system