KEGG   Escherichia coli UM146: UM146_07770Help
Entry
UM146_07770       CDS       T02000                                 

Gene name
argS
Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
elu  Escherichia coli UM146
Pathway
elu00970  Aminoacyl-tRNA biosynthesis
Module
elu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:elu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UM146_07770 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:elu01007]
    UM146_07770 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:elu03016]
    UM146_07770 (argS)
   03029 Mitochondrial biogenesis [BR:elu03029]
    UM146_07770 (argS)
Enzymes [BR:elu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     UM146_07770 (argS)
Amino acid related enzymes [BR:elu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   UM146_07770 (argS)
Transfer RNA biogenesis [BR:elu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UM146_07770 (argS)
 Prokaryotic Type
   Other AARSs
    UM146_07770 (argS)
Mitochondrial biogenesis [BR:elu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    UM146_07770 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1g Ribosomal_L20
Motif
Other DBs
NCBI-ProteinID: ADN70945
Structure
PDB: 

Position
complement(1654859..1656592)
Genome map
AA seq 577 aa AA seqDB search
MNIQALLSEKVRQAMIAAGAPADCEPQVRQSAKVQFGNYQANGMMAVAKKLGMAPRQLAE
QVLTHLDLNGIASKVEIAGPGFINIFLDPAFLAEHVQQALASDRLGVAMPEKQTIVVDYS
APNVAKEMHVGHLRSTIIGDAAVRTLEFLGHKVIRANHVGDWGTQFGMLIAWLEKQQQEN
AGEMELADLEGFYRDAKKHYDEDEEFAERARNYVVKLQSGDEYFREMWRKLVDITMTQNQ
ITYDRLNVTLTRDDVMGESLYNPMLPGIVADLKAKGLAVESEGATVVFLDEFKNKEGEPM
GVIIQKKDGGYLYTTTDIACAKYRYETLHADRVLYYIDSRQHQHLMQAWAIVRKAGYVPE
SVPLEHHMFGMMLGKDGKPFKTRAGGTVKLADLLDEALERARRLVAEKNPDMPADELEKL
ANAVGIGAVKYADLSKNRTTDYIFDWDNMLAFEGNTAPYMQYAYTRVLSVFRKAEIDEEQ
LAAAPVIIREDREAQLAARLLQFEETLTVVAREGTPHVMCAYLYDLAGLFSGFYEHCPIL
SAENEEVRNSRLKLAQLTAKTLKLGLDTLGIETVERM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcaggctcttctctcagaaaaagtccgtcaggccatgattgcggcaggcgcg
cctgcggattgcgaaccgcaggttcgtcagtcagcaaaagttcagttcggcaactatcag
gctaacggcatgatggcagttgctaaaaaactgggtatggcaccgcgacaattagcagag
caggtgctgactcatctggatcttaacggtatcgccagcaaagttgagatcgccggtcca
ggctttatcaacattttccttgatccggcattcctggctgaacatgttcagcaggcgctg
gcgtccgatcgtctcggtgttgctatgccagaaaaacaaaccattgtggttgactactct
gcgccaaacgtggcgaaagagatgcatgtcggtcacctgcgctctaccattattggtgac
gcagcagtgcgtactctggagttcctcggtcacaaagtgattcgcgcaaaccacgtcggc
gactggggcactcagttcggtatgctgattgcatggctggaaaagcagcagcaagaaaac
gccggtgaaatggagctggctgaccttgaaggtttctaccgcgatgcgaaaaagcattac
gacgaggatgaagagtttgccgagcgtgcacgtaactacgtggtaaaactgcaaagcggt
gacgaatatttccgcgagatgtggcgcaaactggtcgacatcaccatgacgcagaaccag
atcacctacgatcgtctgaacgtgacgttgacccgcgatgacgtcatgggtgaaagtctc
tacaacccaatgctgccgggtatcgtggcggacctgaaagccaaaggtctggcagtagaa
agtgaaggcgcgaccgttgtattccttgatgagttcaaaaacaaggaaggcgaaccgatg
ggcgttatcattcagaagaaagatggcggctatctctacaccaccactgatatcgcctgt
gcgaaatatcgttatgaaacactgcatgccgatcgcgtgctgtattacatcgactcccgt
cagcatcaacacctgatgcaggcgtgggctatcgtccgcaaagcaggctatgtaccggaa
tccgtaccgctggaacaccacatgttcggcatgatgctgggtaaagacggcaaaccgttc
aaaacccgcgcgggtggtacagtgaaactggccgatctgctggatgaagccctggagcgt
gcacgccgtctggtggcagaaaagaacccggatatgccagccgacgagctggaaaaactg
gctaacgcggttggtattggtgcggtgaaatatgcggatctctccaaaaaccgcaccacg
gactacatcttcgactgggacaacatgctggcgtttgagggtaataccgcgccatacatg
cagtatgcttacacgcgtgtattatccgtgttccgtaaagcagaaattgacgaagagcaa
ctggctgcagctccggtaatcatccgtgaagatcgtgaagcgcaactggcagctcgcctg
ctgcagtttgaagaaaccctcactgtggttgcccgtgaaggcacgccgcatgtgatgtgt
gcttacctgtacgatctggccggtctgttctctggcttctacgagcactgcccgatcctc
agcgcagaaaacgaagaagtgcgtaacagccgtctgaaactggcacaactgacggcgaag
acgctgaagctgggtctggatacgctgggtattgagacagtagagcgtatgtaa

DBGET integrated database retrieval system