KEGG   Escherichia coli UM146: UM146_07825Help
Entry
UM146_07825       CDS       T02000                                 

Gene name
ntpA
Definition
(GenBank) dATP pyrophosphohydrolase
  KO
K08310  dihydroneopterin triphosphate diphosphatase [EC:3.6.1.67]
Organism
elu  Escherichia coli UM146
Pathway
elu00790  Folate biosynthesis
elu01100  Metabolic pathways
Module
elu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UM146_07825 (ntpA)
Enzymes [BR:elu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.67  dihydroneopterin triphosphate diphosphatase
     UM146_07825 (ntpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ADN70956
Structure
PDB: 

Position
1667904..1668347
Genome map
AA seq 147 aa AA seqDB search
MAYKRPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTGSVEEGETAPQAAMREVKEEVTI
DVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTESWFCLALPHERQIVFTEHLAYKW
LDASAAAALTKSWSNRQAIEQFVINAA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcttataagcgtcccgtttcgatcttagtggtcatctacgcacaagatacgaaacgg
gtgctgatgttgcagcggcgtgacgatcccgatttctggcagtcggtaaccggcagcgtg
gaagagggtgaaaccgcgccgcaagctgccatgcgcgaagtaaaggaagaggtcaccatt
gatgttgtcgctgaacaactgaccttaattgactgtcagcgcacggtagagtttgaaatt
ttttcacatttacgtcatcgctatgcgccgggcgtgacgcgtaatacggaatcatggttc
tgtcttgcgcttccgcacgagcgccagatcgttttcactgaacatctggcttacaagtgg
cttgatgcgtctgctgcggcggcgctcactaagtcctggagcaaccggcaggcgattgaa
cagtttgtaattaacgctgcctga

DBGET integrated database retrieval system