KEGG   Escherichia coli UM146: UM146_07860Help
Entry
UM146_07860       CDS       T02000                                 

Gene name
znuC
Definition
(GenBank) high-affinity zinc transporter ATPase
  KO
K09817  zinc transport system ATP-binding protein [EC:3.6.3.-]
Organism
elu  Escherichia coli UM146
Pathway
elu02010  ABC transporters
Module
elu_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:elu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    UM146_07860 (znuC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elu02000]
    UM146_07860 (znuC)
Enzymes [BR:elu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     UM146_07860 (znuC)
Transporters [BR:elu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    UM146_07860 (znuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_16 SMC_N AAA_23 AAA_22 AAA_25 Rad17 AAA_15 AAA_27 AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: ADN70963
Position
complement(1673181..1673936)
Genome map
AA seq 251 aa AA seqDB search
MTSLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLGLVTPDEGV
IKRNGKLRIGYVPQKLYLDTTLPLTVNRFLRLRPGTHKEDILPALKRVQAGHLINAPMQK
LSGGETQRVLLARALLNRPQLLVLDEPTQGVDVNGQVALYDLIDQLRRELDCGVLMVSHD
LHLVMAKTDEVLCLNHHICCSGTPEVVSLHPEFISMFGPRGAEQLGIYRHHHNHRHDLQG
RIVLRRGNDRS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtctggtttccctggaaaatgtctcggtttcttttggccaacgccgcgtcctc
tctgatgtgtcgctggaacttaaacctggaaaaattttgactttacttgggccaaacggc
gcaggtaagtcgacactggtacgggtagtgctcggactggtaacacccgatgaaggggtt
atcaagcgcaacggaaaactgcgcatcggctatgtaccgcagaagctgtatctcgacacc
acgttgccactgaccgtaaaccgttttttacgcttacgccctggcacacataaagaagat
attttgcctgcactgaaacgtgtccaggccgggcatctgattaacgcaccgatgcaaaag
ctctcgggtggcgaaacgcagcgtgtactgttagcgcgagcattgttaaatcgaccgcaa
ttattagtgctggatgaacccactcagggcgtggatgtgaatggtcaggtggcgttatat
gaccttattgaccaactgcgtcgtgaactggattgtggcgttttaatggtatctcacgat
ctgcatctggtaatggcaaaaaccgatgaagtgctttgcctgaatcaccacatttgttgt
tccggcacaccggaagttgtttccctgcatccggagtttatttctatgtttggtcctcgt
ggtgctgaacaactgggtatctatcgccatcatcataatcatcgtcacgatttacaggga
cgaattgttttgcgtcggggaaatgatcgctcatga

DBGET integrated database retrieval system