KEGG   Escherichia coli UM146: UM146_07905Help
Entry
UM146_07905       CDS       T02000                                 

Definition
(GenBank) keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
  KO
K01625  2-dehydro-3-deoxyphosphogluconate aldolase / (4S)-4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.42]
Organism
elu  Escherichia coli UM146
Pathway
elu00030  Pentose phosphate pathway
elu00630  Glyoxylate and dicarboxylate metabolism
elu01100  Metabolic pathways
elu01120  Microbial metabolism in diverse environments
elu01200  Carbon metabolism
Module
elu_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
elu_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
elu_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UM146_07905
   00630 Glyoxylate and dicarboxylate metabolism
    UM146_07905
Enzymes [BR:elu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.14  2-dehydro-3-deoxy-phosphogluconate aldolase
     UM146_07905
   4.1.3  Oxo-acid-lyases
    4.1.3.42  (4S)-4-hydroxy-2-oxoglutarate aldolase
     UM146_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase HMGL-like
Motif
Other DBs
NCBI-ProteinID: ADN70972
Structure
PDB: 

Position
1683841..1684482
Genome map
AA seq 213 aa AA seqDB search
MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRTECAVDAIRAI
AKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPLLKAATEGTIPLIPGISTVSE
LMLGMDYGLKEFKFFPAEANGGVKALQAIAGPFSQVRFCPTGGISPANYRDYLALKSVLC
IGGSWLVPADALEAGDYDRITKLAREAVEGAKL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactggaaaacaagtgcagaatcaatcctgaccaccggcccggttgtaccggtt
atcgtggtaaaaaaactggaacacgcggtgccgatggcaaaagcgttggttgctggtggg
gtgcgcgttctggaagtgactctgcgtaccgagtgcgcagttgacgctatccgtgctatc
gccaaagaagtgcctgaagcgattgtgggtgccggtacggtgctgaatccacagcagctg
gcagaagtcactgaagcaggtgcacagtttgcaattagcccgggtctgaccgagccgctg
ctgaaagctgctaccgaagggactattcctctgattccggggatcagcactgtttccgaa
ctgatgctgggtatggactacggtttgaaagagttcaaattcttcccggctgaagctaac
ggcggtgtgaaagccctgcaggcgatcgcgggtccgttctctcaggtccgtttctgcccg
acaggtggtatttctccggctaactaccgtgactacctggcgctgaaaagcgtgctgtgc
atcggtggttcctggctggttccggcagatgcgctggaagcgggcgattacgaccgcatt
actaagctggcgcgtgaagctgtagaaggcgctaagctgtaa

DBGET integrated database retrieval system