KEGG   Escherichia coli UM146: UM146_07940Help
Entry
UM146_07940       CDS       T02000                                 

Definition
(GenBank) exodeoxyribonuclease X
  KO
K10857  exodeoxyribonuclease X [EC:3.1.11.-]
Organism
elu  Escherichia coli UM146
Pathway
elu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:elu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    UM146_07940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:elu03400]
    UM146_07940
Enzymes [BR:elu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.-  
     UM146_07940
DNA repair and recombination proteins [BR:elu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA exonucleases
     UM146_07940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T
Motif
Other DBs
NCBI-ProteinID: ADN70979
Structure
PDB: 

Position
complement(1689815..1690477)
Genome map
AA seq 220 aa AA seqDB search
MLRIIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVAD
KPWIEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALYKT
RKLNVQTPPGLHHHRALYDCYITAALLIDIMNTSGWTAEQMADITGRPSLMTTFTFGKYR
GKAVSDVAERDPGYLRWLFNNLDSMSPELRLTLKHYLENT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcattatcgatacagaaacctgcggtttgcagggagggatcgtagagattgcc
tctgttgatgtcattgacggaaaaatcgtcaatcccatgagccacctggtgcgtcccgat
cgtcctattagtccacaggcgatggcgattcatcgcatcaccgaagccatggtcgccgat
aaaccgtggattgaagatgtgatcccgcactattacggtagtgaatggtatgtcgcgcat
aacgccagctttgaccgccgcgtactgcctgaaatgcccggtgagtggatttgcactatg
aaactggcccgtcgtttgtggccagggatcaagtacagcaatatggcgctatataaaaca
cggaagctcaatgtacagacgccgccgggcctgcatcatcaccgcgcgttgtatgactgt
tatatcaccgccgcgttgcttatcgatattatgaacacctctggctggacggcagaacag
atggccgatatcaccggacgtccatcgttgatgacgaccttcacctttggcaaataccgt
ggcaaagcggtttccgacgttgccgaacgcgatccgggctatctgcgctggttgtttaat
aacctcgacagcatgagcccggagctgcgtttaacactgaaacattatctggaaaatact
taa

DBGET integrated database retrieval system