KEGG   Escherichia coli UM146: UM146_07970Help
Entry
UM146_07970       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADN70985
Position
1693249..1693401
Genome map
AA seq 50 aa AA seqDB search
MISNKKPPQFFHQNGRFLTFKLMTTTLFIDHFARKLENLASSSILKEQGN
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
ttgatttccaataaaaaaccgcctcagttctttcaccagaacgggcggtttttaacattt
aagctgatgaccaccacgctttttattgaccattttgcacgcaaactggaaaacctggcg
tcgtcatctattcttaaagagcaaggcaactaa

DBGET integrated database retrieval system