KEGG   Escherichia coli UM146: UM146_07985Help
Entry
UM146_07985       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1480
Motif
Other DBs
NCBI-ProteinID: ADN70988
Position
complement(1694579..1694815)
Genome map
AA seq 78 aa AA seqDB search
MKTSVRIGAFEIDDGELHGESPGDRTLTIPCKSDPDLCMQLDAWDAETSIPALLNGEHSV
LYRTRYDQQSDAWIMRLA
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccagtgtgcgcataggcgcttttgaaatcgacgacggcgaattacacggcgaa
tcgccgggtgatcgaacgttaaccattccttgtaaatcagaccccgatttatgtatgcaa
ctggatgcctgggatgctgaaaccagtatccctgccctgctaaatggcgaacactctgtc
ctttaccgtacccgttacgatcaacaatctgatgcctggattatgcgtcttgcctga

DBGET integrated database retrieval system