KEGG   Escherichia coli UM146: UM146_08055Help
Entry
UM146_08055       CDS       T02000                                 

Definition
(GenBank) Cold shock-like protein cspC
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elu03000]
    UM146_08055
Transcription factors [BR:elu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    UM146_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: ADN71002
Position
1709159..1709368
Genome map
AA seq 69 aa AA seqDB search
MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKG
PAAVNVTAI
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagattaaaggtcaggttaagtggttcaacgagtctaaaggttttggcttcatt
actccggctgatggcagcaaagatgtgttcgtacacttctccgctatccagggtaatggt
ttcaaaactctggctgaaggtcagaacgttgagttcgaaattcaggacggtcagaaaggt
ccggcagctgttaacgtaacagctatctga

DBGET integrated database retrieval system