KEGG   Escherichia coli UM146: UM146_08100Help
Entry
UM146_08100       CDS       T02000                                 

Definition
(GenBank) L-serine deaminase I
  KO
K01752  L-serine dehydratase [EC:4.3.1.17]
Organism
elu  Escherichia coli UM146
Pathway
elu00260  Glycine, serine and threonine metabolism
elu00270  Cysteine and methionine metabolism
elu01100  Metabolic pathways
elu01110  Biosynthesis of secondary metabolites
elu01130  Biosynthesis of antibiotics
elu01200  Carbon metabolism
elu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UM146_08100
   00270 Cysteine and methionine metabolism
    UM146_08100
Enzymes [BR:elu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.17  L-serine ammonia-lyase
     UM146_08100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha SDH_beta MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: ADN71011
Position
complement(1718298..1719662)
Genome map
AA seq 454 aa AA seqDB search
MISLFDMFKVGIGPSSSHTVGPMKAGKQFVDDLVEKGLLDSVTRVAVDVYGSLSLTGKGH
HTDIAIIMGLAGNEPATVDIDSIPGFIRDVEERERLLLAQGRHEVDFPRDNGMRFHNGNL
PLHENGMQIHAYNGDEVVYSKTYYSIGGGFIVDEEHFGQDAANEVSVPYPFKSATELLAY
CNETGFSLSGLAMQNELALHSKKEIDEYFAHVWQTMQACIDRGMNTEGVLPGPLRVPRRA
SALRRMLVSSDKLSNDPMNVIDWVNMFALAVNEENAAGGRVVTAPTNGACGIVPAVLAYY
DHFIESVSPDIYTRYFMAAGAIGALYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGG
SPEQVCVAAEIGMEHNLGLTCDPVAGQVQVPCIERNAIASVKAINAARMALRRTSAPRVS
LDKVIETMYETGKDMNAKYRETSRGGLAIKVQCD
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgattagtctattcgacatgtttaaggtggggattggtccctcatcttcccataccgta
gggcctatgaaggcgggtaaacagttcgtcgatgatctggtcgaaaaaggcttactggat
agcgttactcgcgttgccgtggacgtttatggttcactgtcgctgacgggtaaaggccac
cacaccgatatcgccattattatgggtcttgcaggtaacgaacctgccaccgtggatatc
gacagtattcccggttttattcgcgacgtagaagagcgcgaacgtctgctgctggcacag
ggacggcatgaagtggatttcccgcgcgacaacgggatgcgttttcataacggtaacctg
ccgctgcatgaaaacggtatgcaaatccacgcctataacggcgatgaagtcgtctacagc
aaaacttattattccatcggcggcggttttatcgtcgatgaagaacactttggtcaggat
gctgccaacgaagtgagcgtgccgtatccgttcaaatctgccaccgaactgctcgcgtac
tgtaatgaaaccggcttttcgctgtctggtctcgctatgcaaaacgaactggcgctgcac
agcaagaaagagatcgacgagtatttcgcgcatgtctggcaaaccatgcaggcatgtatc
gatcgcgggatgaataccgaaggcgtactgccaggcccgttgcgcgtgccacgtcgtgcg
tcggccctgcgccggatgctggtttccagcgataaactgtctaacgatccgatgaatgtc
attgactgggtaaacatgtttgcgctggcagttaacgaagaaaacgccgccggtggccgt
gtggtaactgcgccaactaacggtgcctgcggtatcgttccggcagtgctggcttactat
gaccactttattgaatcagttagcccagacatctatacccgttactttatggcagcgggc
gcgattggtgcactgtataaaatgaacgcgtctatttccggtgcggaagtcggttgccag
ggcgaagtaggtgttgcctgttcaatggctgctgcgggccttgccgagctgttgggcggt
agcccggaacaggtttgtgtggcagcggaaattggcatggaacacaacctcggtctgacc
tgcgaccccgttgcagggcaagttcaggtgccgtgcattgaacgtaatgccattgcctct
gtgaaggcgattaacgccgcgcggatggccctgcgtcgcaccagtgcaccgcgcgtctcg
ctggataaggtcatcgaaacgatgtacgaaaccggtaaggacatgaacgctaaataccgc
gaaacctcacgcggtggtctggcaatcaaagtccagtgtgactaa

DBGET integrated database retrieval system