KEGG   Escherichia coli UM146: UM146_08160Help
Entry
UM146_08160       CDS       T02000                                 

Definition
(GenBank) hypothetical protein
Organism
elu  Escherichia coli UM146
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1971 Cupin_2 DUF386
Motif
Other DBs
NCBI-ProteinID: ADN71023
Structure
PDB: 

Position
1731084..1731443
Genome map
AA seq 119 aa AA seqDB search
MLQIPQNYIHTRSTPFWNKQTAPAGIFERHLDKGTRPGVYPRLSVMHGAVKYLGYADEHS
AEPDQVILIEAGQFAVFPPEKWHNIEAMTDDTYFNIDFFVAPEVLMEGAQQRKVIHNGK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaatcccacagaattatattcatacgcgctcaacgcctttctggaataaacaa
actgcgcctgccggaatattcgaacgtcatcttgataaaggaacgcgcccgggggtttac
ccacgcctttccgttatgcatggggcggtcaaatatctcggctacgctgatgaacacagt
gcagagcctgatcaggtgatccttatcgaagcggggcagtttgcggtgttccctccagaa
aagtggcacaacattgaagccatgactgacgatacttatttcaacattgacttcttcgtt
gctcctgaagtcctgatggaaggcgcgcaacaacggaaagtcattcataacgggaaatga

DBGET integrated database retrieval system