KEGG   Escherichia coli UM146: UM146_09395Help
Entry
UM146_09395       CDS       T02000                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
elu  Escherichia coli UM146
Pathway
elu00220  Arginine biosynthesis
elu00250  Alanine, aspartate and glutamate metabolism
elu00471  D-Glutamine and D-glutamate metabolism
elu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UM146_09395
   00220 Arginine biosynthesis
    UM146_09395
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    UM146_09395
Enzymes [BR:elu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     UM146_09395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase CCD
Motif
Other DBs
NCBI-ProteinID: ADN71262
Position
1972307..1973233
Genome map
AA seq 308 aa AA seqDB search
MAVAMDNAILENILRQVRPLIGQGKVADYIPALATVDGSRLGIAICTVDGQLFQAGDAQE
RFSIQSISKVLSLVVAMRHYSEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEVVRGLSGVSDISYDTVVARSEFEHSARNAAIAWLMKSFGN
FHHDVTTVLQNYFHYCALKMSCVELARTFVFLANQGKAIHIDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDDAGNSLAGIAVLEQLT
KQLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggcagtcgccatggataatgcaattttagaaaacatcttgcggcaagtgcggccgctc
attggtcagggtaaagtcgcggattatattccggcgctggctacggtagacggttcccga
ttggggattgctatctgtaccgttgacggacagctttttcaggccggagacgcgcaagaa
cgtttttccattcagtctatttccaaagtgctgagtctcgttgtcgccatgcgtcattac
tccgaagaggaaatctggcaacgcgtcggcaaagatccgtctggatcaccgttcaattct
ttagtgcaactggaaatggagcagggtattccgcgtaatccgtttattaatgccggtgcg
ctggtggtctgcgatatgttgcaagggcgattaagcgctcctcggcaacgtatgctggaa
gtcgtgcgcggcttaagtggtgtgtctgatatttcctacgatacggtggtagcgcgttcc
gaatttgaacattccgcgcgaaatgcggctatcgcatggctgatgaagtcgtttggcaat
ttccatcatgacgtgacaaccgttctgcaaaactactttcattactgcgctctgaaaatg
agctgtgtagagctggcccggacgtttgtctttctggcgaatcaggggaaagctattcat
attgatgaacctgtggtgacgccaatgcaggcgcggcaaattaacgcgctgatggcgacc
agcggtatgtaccagaacgcgggggagtttgcctggcgggtgggactaccggcaaaatct
ggcgttggtggcggtattgtggcgattgttccgcatgaaatggccatcgctgtctggagt
ccggaactggatgatgccggtaactcgcttgcgggcattgcagtccttgaacaattgacg
aaacaattagggcgttcagtttattaa

DBGET integrated database retrieval system