KEGG   Escherichia coli UM146: UM146_09635Help
Entry
UM146_09635       CDS       T02000                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
elu  Escherichia coli UM146
Pathway
elu00620  Pyruvate metabolism
elu01200  Carbon metabolism
elu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UM146_09635
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UM146_09635
Enzymes [BR:elu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     UM146_09635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-ProteinID: ADN71310
Position
2021398..2023095
Genome map
AA seq 565 aa AA seqDB search
MEPKTKKQRSLYIPYAGPVLLEFPLLNKGSAFSMEERRNFNLLGLLPEVVETIEEQAERA
WIQYQGFKTEIDKHIYLRNIQDTNETLFYRLVNNHLDEMMPVIYTPTVGAACERFSEIYR
RSRGVFISYQNRHNMDDILQNVPNHNIKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT
ACGGISPAYTLPVVLDVGTNNQQLLNDPLYMGWRNPRITDDEYYEFVDEFIQAVKQRWPD
VLLQFEDFAQKNAMPLLNRYRNEICSFNDDIQGTAAVTVGTLIAASRAAGGQLSEKKIVF
LGAGSAGCGIAEMIIAQTQREGLSEEAARQKVFMVDRFGLLTDKMPNLLPFQTKLVQKRE
NLSDWDTDSDVLSLLDVVRNVKPDILIGVSGQTGLFTEEIIREMHKHCPRPIVMPLSNPT
SRVEATPQDIIAWTEGNALVATGSPFNPVVWKDKIYPIAQCNNAFIFPGIGLGVIASGAS
RITDEMLMSASETLAQYSPLVLNGEGLVLPELKDIQKVSRAIAFAVGKMAQQQGVAVKTS
AEALQQAIDDNFWHAEYRDYRRTSI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaaaaacaaaaaaacagcgttcgctttatatcccttacgctggccctgtattg
ctggaatttccgttgttgaataaaggcagcgccttcagcatggaagaacgccgtaacttc
aacctgctggggttactgccggaagtggtcgaaaccatcgaagaacaagcggaacgagca
tggatccagtatcagggattcaaaaccgaaatcgacaaacacatctacctgcgtaacatt
caggacactaacgaaaccctcttctaccgtctggtaaacaatcatcttgatgaaatgatg
ccagtcatttacaccccaaccgtcggcgcagcctgtgagcgtttttctgagatctaccgc
cgttcacgcggtgtgtttatctcttaccagaaccgccacaatatggacgatattctgcaa
aacgtaccaaaccataatatcaaagtgattgtggtgactgacggcgaacgtattctgggg
cttggtgaccagggcatcggcgggatgggcattccgatcggtaaactgtcgctctatacc
gcctgtggcggcatcagtccggcctatacccttccggtggtgctggatgtcggcactaac
aaccaacagctacttaacgatccgctgtatatgggctggcgtaatccgcgtatcactgac
gacgaatactatgaattcgttgatgaatttatccaggctgtgaaacaacgctggccggac
gtactgttgcagtttgaagacttcgcacaaaaaaatgcgatgccgttacttaaccgctat
cgcaatgaaatttgttcttttaacgatgacattcagggcaccgcggcggtaacagtcggc
acactgatcgcagccagccgcgcggcaggtggtcagttaagcgagaaaaaaatcgtcttc
cttggcgcaggttcagcgggatgcggcattgccgaaatgatcatcgcccagacccagcgc
gaaggattaagcgaggaagcggcgcggcagaaagtctttatggtcgatcgctttggcctg
ctgaccgacaagatgccgaacctgctgcctttccagaccaaactggtgcagaagcgcgaa
aatctcagtgactgggataccgacagcgatgtgctgtcactgctggatgtggtgcgtaat
gtaaaaccagatattctgattggcgtctcaggacagaccgggctgtttacggaagagatc
atccgtgagatgcataaacactgtccgcgtccgatcgtgatgccgctgtctaacccgacg
tcacgcgtggaagccacaccgcaggacattatcgcctggactgaaggtaacgcgctggtc
gccactggcagtccgtttaatccagtggtatggaaagataaaatctaccctatagcccag
tgcaacaacgcctttattttcccgggcatcgggctgggtgttattgcttccggcgcgtca
cgtatcaccgatgagatgctgatgtcggcaagtgaaacgcttgctcagtattcgccgctg
gtcctgaacggcgaaggtctggtactaccggaactgaaagatattcagaaagtctcccgc
gcaattgcctttgcggttggcaaaatggcgcagcagcaaggcgtggcggtgaaaacgtct
gccgaagctctgcaacaggccattgatgataatttctggcacgccgaataccgcgactac
cgccgtacctccatctaa

DBGET integrated database retrieval system