KEGG   Escherichia coli UM146: UM146_13770Help
Entry
UM146_13770       CDS       T02000                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
elu  Escherichia coli UM146
Pathway
elu00780  Biotin metabolism
elu01100  Metabolic pathways
Module
elu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    UM146_13770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:elu01007]
    UM146_13770
Enzymes [BR:elu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     UM146_13770
Amino acid related enzymes [BR:elu01007]
 Aminotransferase (transaminase)
  Class II
   UM146_13770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ADN72119
Structure
PDB: 

Position
complement(2840944..2842098)
Genome map
AA seq 384 aa AA seqDB search
MIWQEKIDAALDARRVADALRRRYPVAQGAGRWLVADDCQYLNFSSNDYLGLSHHPQIIR
AWQQGADQFGVGSGGSGHVSGYSVAHQVLEEELAEWLGYSRALLFISGFAANQAVIAAMM
AKEDRIVADRLSHASLLEAASLSPSPLRRFAHNDVTHLARLLASPCPGQQLVVTEGVFSM
DGDSAPLEEIQQVTQQHDGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGV
SGAAVLCSNTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALIT
RFRAGVQDLPFTLAGSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARL
RLTLTAAHEMQDIDRLLEVLHGNG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatctggcaggagaaaatcgacgcggcgcttgatgcgcggcgtgttgctgatgccttg
cgtcgccgttatccggtggcacaaggagccggacgctggctggtggcagatgattgccag
tatctgaacttttccagtaacgattatttaggtttaagccatcatccgcaaattatccgc
gcctggcagcagggcgcggatcaatttggtgtcggtagcggcggttccggtcacgtcagc
ggttatagcgtggcgcaccaggtgctggaagaagaactggccgaatggctgggctattcg
cgggcgctgctgtttatttctggttttgccgctaatcaggctgtcattgccgcgatgatg
gcgaaagaggaccgtattgttgccgaccggcttagccatgcctcattgctggaggctgca
agtttaagcccgtcgccgcttcgccgttttgctcataacgatgtcactcatctggcgcga
ctgcttgcttccccctgtccggggcagcaactggtagtgacagaaggtgtgttcagcatg
gacggcgatagtgcgccactggaggaaatccagcaggtaacgcaacagcacgatggctgg
ttgatggtcgatgacgcccacggcacgggcgttatcggggagcaggggcgtggcagctgc
tggctgcaaaaggtaaaaccagaattgctggtggtgacgtttggcaaaggatttggcgtc
agcggggcagcggtgctttgctccaatacggtggcggattatctgctgcaattcgctcgc
catcttatctacagcaccagtatgccgcccgctcaggcgcaggcattacgtgcgtcgctg
gcggtcattcgcagtgatgagggggatgcacggcgcgaaaaactggcggcactcattacg
cgttttcgtgccggagtgcaggatttgccgtttacgcttgctggctcatgcagcgccatc
cagccattgatcgtcggtgataacagccgtgcgttacaactggcagaaaaactgcgccag
caaggctgctgggtcacggcgattcgcccgccaaccgtacccgctggtactgcgcgactg
cgcttaacgctaaccgcagcgcatgaaatgcaggatatcgaccgtctgctggaggtgctg
catggcaacggttaa

DBGET integrated database retrieval system