KEGG   Escherichia coli UM146: UM146_16805Help
Entry
UM146_16805       CDS       T02000                                 

Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase
  KO
K03772  FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC:5.2.1.8]
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:elu03110]
    UM146_16805
Enzymes [BR:elu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     UM146_16805
Chaperones and folding catalysts [BR:elu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    UM146_16805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C FKBP_N DUF4827 Stathmin BURP
Motif
Other DBs
NCBI-ProteinID: ADN72715
Structure
PDB: 

Position
complement(3476685..3477497)
Genome map
AA seq 270 aa AA seqDB search
MKSLFKVTLLATTMAVALHAPITFAAEAAKPATTADSKAAFKNDDQKSAYALGASLGRYM
ENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKD
AADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKE
FDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLV
FDVELLDVKPAPKADAKPEADAKAADSAKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactgtttaaagtaacgctgctggcgaccacaatggccgttgccctgcatgca
ccaatcacttttgctgctgaagctgcaaaacctgctacaactgctgacagcaaagcagcg
ttcaaaaatgacgatcagaaatcagcttatgcactgggtgcttcgctgggtcgttacatg
gaaaactctcttaaagaacaagaaaaactgggcatcaaactggataaagatcagctgatc
gctggtgttcaggatgcatttgctgataagagcaaactttccgaccaagagatcgaacag
actctgcaagcattcgaagctcgtgtgaagtcttctgctcaggcgaagatggaaaaagac
gcggctgataacgaagcaaaaggtaaagagtaccgcgagaaatttgccaaagagaaaggt
gtgaaaacctcttccactggtctggtttatcaggtagtagaagccggtaaaggcgaagcc
ccgaaagacagcgatactgttgtagtgaactacaaaggtacgctgatcgacggtaaagag
ttcgacaactcttacacccgtggtgaaccgctctctttccgtctggacggtgttatcccg
ggttggacagaaggtctgaagaacatcaagaaaggcggtaagatcaaactggttattcca
ccagaactggcttacggcaaagcgggtgttccggggatcccaccgaattctaccctggtg
tttgacgtagagctgctggatgtgaaaccagcgccgaaggctgatgcaaagccggaagct
gatgcgaaagccgcagactctgctaaaaaataa

DBGET integrated database retrieval system