KEGG   Escherichia coli UM146: UM146_22710Help
Entry
UM146_22710       CDS       T02000                                 

Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
elu  Escherichia coli UM146
Pathway
elu00760  Nicotinate and nicotinamide metabolism
elu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    UM146_22710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elu03000]
    UM146_22710
Enzymes [BR:elu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     UM146_22710
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     UM146_22710
Transcription factors [BR:elu03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    UM146_22710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 HTH_26 Citrate_ly_lig CTP_transf_like MMR_HSR1 FAD_syn HTH_37 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ADN73864
Position
4746025..4747257
Genome map
AA seq 410 aa AA seqDB search
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRYLGLEFP
RQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSAMSQQPTV
PDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPDLIYTSEE
ADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKEFQNLLVEMLEENNIEFVRVEEDDYDSRFLRCVELVREMMGEQR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatttgattacctgaaaactgccatcaagcaacagggctgcactctacagcag
gtagctgatgccagcggtatgaccaaagggtatttaagccagttactgaatgccaaaatt
aaaagccccagcgcacaaaagctggaggcattgcaccgttatttgggacttgaatttccc
cggcagaagaaaacgatcggtgtcgtattcggtaagttttacccgctgcatactggacat
atctaccttatccagcgcgcctgtagccaggttgacgagctgcatatcattatgggtttt
gacgatacccgcgaccgcgcattgttcgaagacagcgccatgtcgcagcagccaaccgtg
ccggatcgtctgcgctggttattgcagacctttaagtatcaaaaaaatatccgcattcat
gcttttaacgaagagggcatggaaccgtatccacacggctgggatgtgtggagcaacggc
atcaaaaagtttatggccgaaaaaggcattcagccggacctgatctacacctcggaagaa
gccgatgcgccgcagtatatggaacatctggggatcgagacggtgctggtcgatccgaag
cgtacctttatgagtatcagcggtgcgcagatccgcgaaaacccgttccgctactgggaa
tatattcctacggaagtgaagccattctttgtgcgtaccgtggcgatcctcggtggtgaa
tcgagcggtaaatccaccctggtaaacaaacttgccaatatcttcaacactaccagtgcg
tgggaatatggtcgtgattatgtcttttcgcacctcggtggcgatgagatcgcgttgcag
tattccgactacgataaaatcgcgctgggacatgcgcaatatattgattttgcagtgaaa
tatgccaataaagtggcgtttatcgacaccgattttgtcactacccaggcgttctgcaaa
aagtacgaagggcgtgagcatccgttcgtgcaggcgttgattgatgagtaccgtttcgat
ctggtgatcctgctggagaacaacacgccgtgggtggcggatggtttacgcagcctcggc
agttcggtggatcgcaaagagttccagaacttgctggtggagatgctggaagagaacaat
atcgaattcgtgcgggttgaagaggacgattacgacagccgtttcctgcgctgcgtggag
ctggtgcgggagatgatgggggagcaaagataa

DBGET integrated database retrieval system