KEGG   Escherichia coli W: ECW_m0218
Entry
ECW_m0218         CDS       T02002                                 

Gene name
etsA2
Definition
(GenBank) T6SS-associated protein
  KO
K11911  type VI secretion system protein VasL
Organism
elw  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:elw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elw02044]
    ECW_m0218 (etsA2)
Secretion system [BR:elw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECW_m0218 (etsA2)
SSDB
Motif
Pfam: VasL ImpA_N
Other DBs
NCBI-ProteinID: ADT73760
UniProt: E0J668
Position
complement(240905..242257)
AA seq 450 aa
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDL
HTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNIL
RQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTV
RGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLL
DTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLH
AFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNVMPEAATGTTAEK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaatagtaacgtactgacacaaactatcgttaccggcagtgacccgcgcgggctgccg
gaattcagtgccatccgcgaggaaataaacaaagccagccacccgtcacagcctgagctg
aactggaaactggtggagtcgctggcactggcgatttttaaagccaacggtgtggattta
cacaccgccacctactatacgcttgcccggacacggacacagggactggcgggattctgc
gaaggtgcggaactgctggcggcaatggtaagccacgactgggataagttctggccgcag
ggcggcccggcgcgtactgaaatgctggactggtttaactcccgaaccggcaatattctg
cgtcagcaaatctcctttgcggaatccgacctaccactgatctaccgcacagagcgggca
ttgcagcttatctgcgataagctccagcaggtggaactgaagcgcgttccgcgcgtggag
aatctgctctattttatgcagaacacgcgtaaacggcttgaaccccagctgaagagtaac
actgagaacgccgcacagaccacggtcagaacgctgatttatgccccggaaacacaggca
tcttccacaccagaagcggtagtgcctcccctgcccggcctgcctgagatgaaagtggaa
gtgcgcagtctgacagagaatcccccacaggccagtgtgataaagcaaggcagtacggta
agagggtttatcgcagggatcgcctgttcagtggctgtcgcctcagcattgtggtggtgg
caggtctatccggtacagcagcaactgttacaggttaacgacaccgctcagggcgcagca
acggtgtggatggcctcacctgaactcgaaaactatgagcgcaggctgcaacaacttctt
gatacctccccggtacagccgctggaaaccgggatgcagatgatgcgtgttgccgacagt
cgctggccggaaagcctgcaacagcaacaggcctcgacacaatggaatgaggcactcaaa
acccgcgcacagagtagcccgcagttgcgtggctggttgcagacccgccaggacttacat
gcttttgcagatctagtgatgcagcgcgagaaagagggactaaccctttcctatatcaaa
aatgtcatctggcaggcggagcggggactggggcaggaaacacccgttgagtctctgttg
acgcagtaccaggatgcccgtgcgcagaagcagaatacagatgcgctggaaaaacaaatt
aatgagcgactcgaaggcgtgttaagccgctggctgctgctgaagaataacgtcatgcca
gaggcggcaaccggtaccacggccgaaaaataa

DBGET integrated database retrieval system