KEGG   Escherichia coli W: ECW_m0220
Entry
ECW_m0220         CDS       T02002                                 

Gene name
etsA
Definition
(GenBank) ImpA domain-containing protein
  KO
K11910  type VI secretion system protein VasJ
Organism
elw  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:elw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elw02044]
    ECW_m0220 (etsA)
Secretion system [BR:elw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECW_m0220 (etsA)
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N FAM86
Other DBs
NCBI-ProteinID: ADT73762
UniProt: E0J666
Position
complement(245811..247223)
AA seq 470 aa
MAMDLRDPNVWVSHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSLAHSQLDIPELQR
RGLVILASESKDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRFAS
QVIKRFETGIEVFSQNAATAQRDALSGELAKLAQCWQSHNAPELAQATDDLFALYQRAFN
RAAPAPVPTPAASGSSPQTTATSESGVTQPSAPAPQIVIDSHDDKAWRDTLLKVAAILCE
RQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSADMVADYHAQLGSADMALWQQV
EKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRFLERLPQLTGLLFNDHTPFIS
EQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggcaatggacttacgcgatccgaatgtctgggtatcgcacctgctggaaaacctgccg
gaagagaaactggcatcggcgctgaaagatgacaacccgaactgggagtatatcgacggc
gaaatcgtcaagctgggatcgctggcccacagtcaactggatatcccggaactccagcgc
cgggggctggtcattctggcttcggagagtaaggattttcgtctgctggcgcatctgctg
agaaccctgcaacacgccggtgatcctcatctcgcattgcgcctgctggcgctgtatgtg
gagcattactgggcggtggctgcgccgcagaatatggcgcataaaaaacgctttgccagc
caggtcattaaacgctttgaaacaggtattgaagttttttcacagaacgccgccacagcg
cagcgcgatgcgctgtcaggggaactggcaaaactggcgcaatgctggcagtcacataac
gccccggaactggcacaggctactgatgatctttttgccctgtaccagcgtgcgtttaat
cgtgcggcaccggctcctgtccccactccggcggcctccggtagttcaccacagaccacc
gccacgtctgaaagcggcgtgacgcaacccagtgctccggctccccaaatcgtcatcgac
agtcacgacgacaaagcctggcgcgacacgctgttaaaagtggcggccattttatgtgaa
cgccagccggattcaccgcagggctaccgtctgcgccgccatgcgctttggcagaacatc
accagtacgccccaggcggaaagcgatggccgtactccactggctgcggtctccgccgat
atggtggcagattaccatgctcagctcggtagtgccgatatggcgctgtggcagcaggtg
gagaaaagcgtactgctggctccttactggctggatggtcactgcctttctgcacagacg
gcgctgcgtctgggttacaaacaggtggcagacgccatccgcgatgaggtcatccgcttc
cttgagcgtctgccccagcttaccgggctgctgtttaatgaccacacaccgtttatcagt
gagcagacgaaacaatggctggcagcttcgcccgacgccaaagttgcaccggttgcgcaa
atcggtgaggaatcgaaggcagccagagcctgttttgctgagcagggtctggaggcggcg
ctgcgatatctggacatgctacccgaaggcgatccccgcgatcagtttcaccgccagtac
cttgccgcacagttgacggaagaggcggggctggtacagcttgcgcagcagcagtaccgg
atgttgttcaggatgggattgcagatgatggtggcagactgggagccgtccctgcttgag
cagctagaacaaaaattcacggcagaacaataa

DBGET integrated database retrieval system