KEGG   Escherichia coli W: ECW_m0232
Entry
ECW_m0232         CDS       T02002                                 

Gene name
etsS
Definition
(GenBank) T6SS-associated protein
  KO
K11901  type VI secretion system protein ImpB
Organism
elw  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:elw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elw02044]
    ECW_m0232 (etsS)
Secretion system [BR:elw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECW_m0232 (etsS)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADT73774
UniProt: E0J654
Position
complement(259815..260315)
AA seq 166 aa
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVN
KHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLL
ELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGLVSNK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcaaaaaatttgaaggcagcgtcgcgcctcgcgagcgtattaatatatcgtatgtc
ccaaaaacagatggccagacggctgaagtggaacttccgcttaacatgctcgttgtcggc
gataccggaaatacgcaggaaacatcctcactggatgaacgtcaggcagtttccgttaac
aagcacaatttcggtgcagtgatggctgaagcagccattggcctcaattttactgtcccc
gccaccctgaagggaagcacaacagacgatgaactgaatgtggcgctgaatatcaaatca
ctggatgatttttcaccagatagcgtggcccggcaggttccggaagtgaataaattgctg
gaactgcgtgaagcactgactgcactgaaggggccgatgggtaaccttccggcattccgt
acccagctccaggcattgctggaaaatgaagagtcccgcgagcagttgctcaaagaaatc
ggtctggtgagcaataaataa

DBGET integrated database retrieval system