KEGG   Escherichia coli W: ECW_m0680Help
Entry
ECW_m0680         CDS       T02002                                 

Gene name
ybeM
Definition
(GenBank) putative amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
elw  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:elw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECW_m0680 (ybeM)
Enzymes [BR:elw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     ECW_m0680 (ybeM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ADT74208
UniProt: E0J1Q1
Position
728829..729617
Genome map
AA seq 262 aa AA seqDB search
MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLARDDHDADLSVKSAQLL
EGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNIVARYAKLHLYDAFAIQ
ESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFPELALAQALQGAEILVLPAAWVRGPLKE
HHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTIAAASEMPALIMAEVTPER
VRQVRAQLPVLNNRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctggttgccgcaggacagtttgctgttacatctgtgtgggaaaagaacgctgagatt
tgtgcctcgttgatggcgcaggcggcggaaaacgacgtatcgctgttcgtcctgccggaa
gcattgctggcgcgcgatgatcatgatgcagatctatcggttaaatcagcacagctgctg
gaaggcgaattcctcggacgtttacggcgagaaagtaaacgtaacatgatgacgacaatt
ctgacgattcatgttccttcaacgccggggcgcgcatggaatatgctggtggcgctacag
gcaggaaacatcgtcgcccgttatgccaaattgcatctctatgatgcatttgccattcag
gaatcacgccgtgttgatgctggtaatgaaatcgctccgttactcgaggtggaggggatg
aaggtcggtctgatgacctgttatgacttacgctttccagagctggcgctggcacaggca
ttacagggagctgaaatcctggtacttcctgccgcctgggttcgcgggccgctcaaagag
catcattggtcaacgttgcttgccgctcgtgcgctggataccacctgttatatggtggcg
gcgggggagtgcgggaacaaaaatatcggtcaaagccggattatagatccctttggcgtc
accattgcggcagcgtcagaaatgcctgcactcattatggcggaagtgacgcccgaacgt
gtgcgtcaggtgcgcgcgcaactgcccgtcttaaacaaccgtcgctttgcgccgccgcaa
ttattatga

DBGET integrated database retrieval system