KEGG   Escherichia coli W: ECW_m1544Help
Entry
ECW_m1544         CDS       T02002                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase A, NAD-linked
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
elw  Escherichia coli W
Pathway
elw00620  Pyruvate metabolism
elw00630  Glyoxylate and dicarboxylate metabolism
elw01100  Metabolic pathways
elw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECW_m1544 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    ECW_m1544 (aldA)
Enzymes [BR:elw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     ECW_m1544 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     ECW_m1544 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: ADT75022
UniProt: E0IVP6
Structure
PDB: 

Position
1594050..1595489
Genome map
AA seq 479 aa AA seqDB search
MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEW
EALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWAR
RYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQ
FVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVDG
KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgttcaacatcctatgtatatcgatggacagtttgttacctggcgtgga
gacgcatggattgatgtggtaaaccctgctacagaggctgtcatttcccgcattcccgat
ggtcaggccgaggatgcccgtaaggcaatcgatgcagcagaacgtgcacaaccagaatgg
gaagcgttgcctgcaattgaacgcgccagttggttgcgcaaaatctccgccgggatccgc
gagcgcgccagtgaaatcagtgcgctgattgttgaagaagggggcaagatccagcagctg
gctgaagtcgaagtggcttttactgccgactatatcgattacatggcggagtgggcacgg
cgttacgagggcgagattattcaaagcgatcgtccaggagaaaatattcttctgtttaaa
cgtgcgcttggtgtgactaccggcattctgccgtggaacttcccgttcttcctcattgcc
cgcaaaatggctcccgctcttttgactggtaataccattgtcattaaacccagtgaattt
acgccaaacaatgcgattgcattcgccaaaatcgtcgatgaaataggccttccgcgcggc
gtgtttaaccttgtactggggcgtggtgaaaccgttgggcaagaactggcgggtaaccca
aaggtcgcaatggtcagtatgacaggcagcgtctctgcaggtgaaaagattatggcgact
gcggcgaaaaacatcaccaaagtgtgtctggaattgggtggtaaagcaccagctatcgta
atggacgatgccgatcttgaactggcagtcaaagccatcgttgattcacgcgtcattaat
agtgggcaagtgtgtaactgtgcagaacgtgtttatgtacagaaaggcatttatgatcag
ttcgtcaatcggctgggtgaagcgatgcaggcggttcaatttggtaaccccgctgaacgc
aacgacattgcgatggggccgttgattaacgccgcggcgctggaaagggtcgagcaaaaa
gtggcgcgcgcagtagaagaaggggcgagagtggcgttgggtggcaaagcagtagacggg
aaaggatattattatccgccgacattgctgctggatgttcgccaggaaatgtcgattatg
catgaggaaacctttggcccggttctgccggtggtcgcatttgacacgctggaagatgct
atctcaatggctaatgacagtgattacggcctgacctcatcaatctatacccaaaatctg
aacgtcgcgatgaaagccattaaagggctgaagtttggtgaaacttacatcaaccgtgaa
aacttcgaagctatgcaaggcttccacgccggatggcgtaaatccggtattggcggcgca
gatggtaaacatggcctgcatgaatatctgcagacccaggtggtttatttacagtcgtaa

DBGET integrated database retrieval system