KEGG   Escherichia coli W: ECW_m3031Help
Entry
ECW_m3031         CDS       T02002                                 

Definition
(GenBank) Type IV/VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
elw  Escherichia coli W
Pathway
elw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECW_m3031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elw02044]
    ECW_m3031
Secretion system [BR:elw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECW_m3031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ADT76425
UniProt: E0J229
Position
3104843..3105508
Genome map
AA seq 221 aa AA seqDB search
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESV
EHITYAQCALLDETVLSRSGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAP
AQAVLTCFHRVLLLGFRGRYQDPVAPERDQLISTLNGLVAPFGVLPETAVLNVPLSTRQH
PLLHSPFFWLVTLTLLLAGVWWGLHHWLNVLVDELLPQSLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagacggatatcaatatcgacgcgctgctgcgcgacacgtttctgacggtg
gtggaactgcgtcagggaaccaccgtgcgtcacggtatggagctgtatcgtcactgccag
cggcaggtggaactggtccgcgaacgcctgaaagatgccgggtttagccgggagagcgtg
gagcacattacctacgcgcagtgcgccctgctggacgaaacagtcctgagtcgcagcggc
atggacgacggtcaggccatctggatgaaggatccactccagtcgcatttcttcaacacc
ctgcaggcaggcgagctgctgtacgagcggatgaagcaggtgttgcaggagcccgcgcct
gcacaggctgtgctgacctgctttcaccgtgtcctgctgctgggatttcgcgggcgttat
caggatccggtggccccggagcgcgaccagcttatttcgacgctcaacgggctggtcgcg
ccatttggcgtactgccggaaacggcggtactgaacgtgccgttatccacccgtcagcac
cctttgctgcattcgccgtttttctggctggtaacgctgacgctgctactggccggtgtc
tggtgggggctgcaccactggctgaacgtgctggtggatgaattgctgccgcaaagcctg
cggtaa

DBGET integrated database retrieval system