KEGG   Escherichia coli W: ECW_m3119
Entry
ECW_m3119         CDS       T02002                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
elw  Escherichia coli W
Pathway
elw00230  Purine metabolism
elw01100  Metabolic pathways
elw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECW_m3119 (xdhA)
Enzymes [BR:elw01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECW_m3119 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ADT76497
UniProt: E0IWE7
Position
3197355..3199652
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITTPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttatgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
agaagtttgccgggcgtactggcgatttttacctgggaagatgtgcctgatattccattt
gctactgctgggcatgcctggacacttgacgaaaacaagcgcgataccgccgatcgcgca
ctgctaactcgccatgttcgtcatcatggtgacgccgttgccatcgtcgtggcccgcgat
gaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaagaattacccgtt
atcaccacgccagaagcggcgctggcagaagacgctgcaccaatccataacggtggcaat
ttactgaaacaaagcacgatgtcgacgggtaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagacccccgttattcaacattgtcacatggaaagcgta
acatcgctggcgtggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccgtttgtcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcggcattcctgaccagcaagcttggcggcattccggtgaaagtttcccttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttaccattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccatcgcttctgcgggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgac
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggcaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagaatgccagaaccagcaa
ggcaatttgcgccgcggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgccttctgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggtcagggtgccgacaccgtcttctcgcaaatggtggca
gaaaccgtgggggttccggtcagcgacgttcgcgttatttcaactcaagataccgacgtt
acgccgttcgatcccggcgcatttgcctcacgccagagctatgttgccgcgcctgcgctg
cgcagtgcggcactattattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatctgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgctgaaagctccatcaaaaccaccactaacccaccggcgtttggctgt
acctttgttgatctgacggtcgatattgcgctgtgcaaagtcaccatcaaccgcatcctc
aacgttcatgattcagggcatattcttaatccactgctggcagaaggtcaggtacacggc
ggaatgggaatgggcattggctgggcgctatttgaagagatgatcatcgatgctaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccaccaataattcctgttgccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctgacgccaaaacggttatatgaagagttccat
ctggcaggattgatttga

DBGET integrated database retrieval system