KEGG   Escherichia coli W: ECW_m4189Help
Entry
ECW_m4189         CDS       T02002                                 

Gene name
yihX
Definition
(GenBank) predicted hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
elw  Escherichia coli W
Pathway
elw00010  Glycolysis / Gluconeogenesis
elw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECW_m4189 (yihX)
Enzymes [BR:elw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ECW_m4189 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-ProteinID: ADT77499
UniProt: E0J4S2
Structure
PDB: 

Position
4299718..4300317
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGAWSDLTRVPLATLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGIT
SILVKDKTTIPDYFAKVLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgactttaaccgtgtgctg
ggagcctggagcgatttaacgcgtgttccactggctacgcttaagaagagtttccacatg
ggggaggcgtttcatcagcatgagcgtggggaaattagcgacgaagcgttcgcagaggcg
ctgtgtcatgagatggccctgccgctaagctacgagcagttctctcacggctggcaggcg
gtgtttgttgcgctgcgcccggaagtgatcgccatcatgcataaactgcgtgagcagggg
catcgcgtggtggtgctttccaataccaaccgcctgcataccaccttctggccggaagaa
tacccggaaattcgtgatgctgctgaccatatctatctgtcgcaagatctggggatgcgc
aaacctgaagcacgaatttaccagcatgttttgcaggcggaaggtttttcacccagcgat
acggtctttttcgacgataacgccgataatatagaaggagccaatcagctgggcattacc
agtattctggtgaaagataaaaccaccatcccggactatttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system