KEGG   Escherichia coli W: ECW_m4679Help
Entry
ECW_m4679         CDS       T02002                                 

Gene name
uxuA
Definition
(GenBank) mannonate hydrolase
  KO
K01686  mannonate dehydratase [EC:4.2.1.8]
Organism
elw  Escherichia coli W
Pathway
elw00040  Pentose and glucuronate interconversions
elw01100  Metabolic pathways
Module
elw_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:elw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECW_m4679 (uxuA)
Enzymes [BR:elw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     ECW_m4679 (uxuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UxuA AP_endonuc_2 Catalase-rel Delta_lysin
Motif
Other DBs
NCBI-ProteinID: ADT77951
UniProt: E0J7G9
Structure
PDB: 

Position
4814077..4815261
Genome map
AA seq 394 aa AA seqDB search
MEQTWRWYGPNDPVSLADVRQAGATGVVTALHHIPNGEVWSVEEILKRKAIVEDAGLVWS
VVESVPIHEDIKTHTGNYEQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLP
DGSKALRFDQIEFAAFEMHILKRPGAEADYTEEEIAQAAVRFATMSDEDKARLTRNIIAG
LPGAEEGYTLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDDPPRP
ILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLR
STMREDNPKTFHEAAHLNGDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDL
KKKTNPGYSAIGRLKGLAEVRGVELAIQRAFFSR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacagacctggcgctggtacggcccaaacgatccggtttctttagctgatgtccgt
caggcgggcgcaactggcgtggttaccgcgctgcaccatatcccgaacggcgaagtatgg
tccgtagaagagatcctcaaacgcaaggcgatcgttgaagacgcaggcctggtgtggtct
gtcgtagaaagcgtaccaattcacgaagatatcaaaacccacactggcaactatgagcag
tggatcgctaactatcagcagactctgcgcaacctggcgcagtgtggcattcgcaccgtg
tgctacaacttcatgccggtgctcgactggacccgtactgacctcgaatacgtgctgcca
gacggctccaaagctctgcgcttcgaccagatcgaattcgctgcattcgaaatgcatatc
ctgaaacgtccaggcgcggaagcggattacaccgaagaagaaattgctcaggctgctgtt
cgcttcgccactatgagcgacgaagacaaagcgcgtctgacccgtaacatcattgctggt
cttccgggcgcggaagaaggctacaccctcgaccagttccgtaaacacctggagctgtac
aaagatatcgacaaagcgaagctgcgcgaaaactttgccgtcttcctgaaagcgattatt
ccagttgctgaagaagtcggcgtgcgtatggctgttcacccggacgatccgccgcgcccg
atcctcggcctgccgcgcattgtttccaccattgaagatatgcagtggatggttgatacc
gtaaacagcatggcaaacggttttaccatgtgcaccggttcctacggcgtgcgtgctgac
aacgatctggttgatatgatcaagcagttcggtccgcgtatttacttcacccatctgcgc
tccaccatgcgtgaagataacccgaaaaccttccacgaagcggcgcacctgaacggtgac
gttgatatgtacgaagtggtgaaagcgattgttgaagaagaacaccgtcgtaaagcggaa
ggcaaagaagacctgatcccgatgcgtccggaccacggtcatcagatgctggacgacctg
aagaagaaaaccaacccaggttactccgcaattggtcgtctgaaaggcctggccgaagtt
cgcggtgtcgaactggcgatccagcgcgctttctttagccgttaa

DBGET integrated database retrieval system