KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0221
Entry
CDCO157_0221      CDS       T02122                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CDCO157_0221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elx02044]
    CDCO157_0221
Secretion system [BR:elx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CDCO157_0221
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AFJ27270
Position
complement(253905..254666)
AA seq 253 aa
MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHL
FAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHF
HNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRYKVAVQDQGEFEQIYRRL
YHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGGVVVLALFYLFYLLRLDSQ
TQDILHQLNKLLR
NT seq 762 nt   +upstreamnt  +downstreamnt
atggatgaggggtcactgtctctgccaccatttaccggatacgacgaaaaaagcctgcgc
gactaccatctcgcgcttcatggcaacagcctgaatccgatgatcgacgcggcgacgccg
ctactcggtatggtaatgcgcctttccaccatgaacagccagacgatgccggagcatctt
tttgctcaggtggtgacagatgttcaggccgtggagcaactgcttcaggaacagggctac
gaaccgggcgtgattatctcgtttcgctacatcctctgcacgtttattgatgaagcggcg
ctcggtaacggctggtcgaacaagaacgagtggatcaagcagtcattgctggtccatttc
cacaacgaagcctggggtggcgagaaagttttcatcctgctggagcgcctgatccgtgaa
cccaaacgttaccaggatctgctggaatttctctggctctgtttttctctgggatttcgc
gggcgctacaaagtggcagtacaggatcagggggaatttgagcagatctaccgccgtctg
taccacgttctgcataaactgcgcggcgatgcccctttcccgctgttacaccaggacaaa
aaaacccaaggcgggcgttatcagctcatcagtcgcctgactgttaaacatattttttgt
ggtggcgttgtcgtgctggcgttgttttacctgttctatctgttgcggctggacagccag
acgcaggacatcctgcaccagctaaacaaattacttcgataa

DBGET integrated database retrieval system