KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0228
Entry
CDCO157_0228      CDS       T02122                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Brite
KEGG Orthology (KO) [BR:elx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elx02044]
    CDCO157_0228
Secretion system [BR:elx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CDCO157_0228
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AFJ27277
Position
complement(261235..262626)
AA seq 463 aa
MSLQEEELVSSHAGQPEQESSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASA
EPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVL
HVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQY
VSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGPAYTKWRALRDSEDSRYLG
LTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTAWMLACNIADSFAKYRWCPN
IIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRKDSDNAA
FFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWY
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtctttacaggaagaggaactcgtttccagtcatgccgggcagcctgagcaggaatcg
tcgctgcttgatcaaatcatggcacagacccgtattcagcccggttcggaaggttatgac
gttgcccgccagggtgtgacagcctttattgccagcatcctgcaatccactgcatctgcc
gaaccggtcaataaactggccgtggacagcatgattgcagatattgatgaacgcatcagc
cgccagatggatgtcatcatccatgcgcctgcctttcagcaggtcgagtcgttctggcgc
tcactgaaaaccatggtggatcgcgttgatttccgtgaaaacatcaaggtcaacgtgctt
catgtcaccaagcaggaacttctggaagactttgagtttgcgccagaaattattcagtcc
ggattttataagcacgtttattcgtccggtttcggacagtttggcggtgaacccatcgct
gccgtgctgggcgcttatgagttcaaaaataccgcgcctgacatgaaactgctgcaatac
gtcagtgccgtgggcgcaatggcgcacgcaccgttcctgtcctccgtttccccggagttt
atggggctgaactcgtggaccgaactgcctaatatcaaagatctttatgccatctttgaa
ggtccggcctacaccaaatggcgcgccctgcgtgactcggaagattcgcgctatttaggg
cttacggcaccccgcttcctgcttcgccagccctattcaccaacagataaccctgttaag
aactttaactattacgaagatgtcagccagaaccacgaagattatctgtggggtaatacg
gcctggatgctggcatgcaatatcgcagacagttttgccaaataccgctggtgtccaaac
attatcggtccgcaaagcggcggcgcagtgaaagatctgccggtgcatctgttcgaaacg
atggggcagattcaggccaaaatcccaaccgaggtgctggtcaccgatcgccgcgaattt
gaactggctgaagagggttttatcacccttaccatgcgtaaagactctgataatgcagcc
tttttctctgcaaactcggtacaaaaaccgaagcactttccgggaaaagatgcagaaacc
aactataagctgggtacgcagcttccttatctcttcatcatcaatcggttagcgcactac
atcaaggtgttgcagcgtgaacaactggggtcatggaaagaaaggagcgacttagaaaga
gagcttaatacctggatccgtcagtatgttgccgaccaggaaaacccgcctgcagacgtg
cgcagccgcaaacctctgcgcgctgccaaagttgaggttatggatgtagaaggcgaaccc
ggctggtactag

DBGET integrated database retrieval system