KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0230
Entry
CDCO157_0230      CDS       T02122                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Brite
KEGG Orthology (KO) [BR:elx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elx02044]
    CDCO157_0230
Secretion system [BR:elx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CDCO157_0230
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFJ27279
Position
complement(262936..263436)
AA seq 166 aa
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVN
KHNFGAVMAEAAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDFSPDSVARQVPEVNKLL
ELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQVSNK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcaaaaaatttgaaggcagcgtcgcgcctcgcgaacgtattaatatatcgtatgtc
ccaaaaacagatggccagacggctgaagtggaacttccgcttaacatgctcgttgtcggc
gataccggaaatacgcaggaaacatcctcactggatgaacgtcaggcagtttccgttaac
aagcacaatttcggtgcagtgatggctgaagcagccattggcctcaattttaccgtcccc
gccacgctgaagggaagcacaacggacgatgaaatgaatgtggcgctgaatatcaagtca
ctggatgatttttcaccagatagcgtggcccggcaggttccggaagtgaataaattgctg
gaactgcgtgaagcactgactgcactgaaggggccgatgggtaaccttccggcattccgt
acccagctccaggcattgctggaaaatgaagagtcccgcgagcagttgctcaaagaaatc
ggccaggtgagcaataaataa

DBGET integrated database retrieval system