KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0600Help
Entry
CDCO157_0600      CDS       T02122                                 

Definition
(GenBank) dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00633  Nitrotoluene degradation
elx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CDCO157_0600
Enzymes [BR:elx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     CDCO157_0600
  1.-  
   1.-.-  
    1.-.-.-  
     CDCO157_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AFJ27646
UniProt: A0A0F6C090
Structure
PDB: 

Position
complement(688298..688951)
Genome map
AA seq 217 aa AA seqDB search
MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGNYVFNERKILDASHVVVFCAKTAMDDAWLKLVVDQEDADGRFATPEAKAANDKG
RKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKE
KGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcatttctgtcgccttaaagcgtcattccactaaggcatttgatgccagcaaa
aaacttaccccggaacaggccgagcagatcaaaactctcctgcaatacagcccatccagc
accaactcccagccgtggcattttattgttgccagcacggaagaaggtaaagcgcgtgtt
gccaaatccgctgccggtaattatgtgttcaacgaacgtaaaatacttgatgcctcgcac
gtcgtggtgttctgtgcaaaaaccgcgatggacgatgcctggctgaagctggttgttgac
caggaagatgctgatggccgctttgccacgccggaagcgaaagccgcgaacgataaaggt
cgcaagttcttcgccgatatgcaccgtaaagatctgcatgatgatgcagagtggatggca
aaacaggtttatctcaacgtcggtaatttcctgctcggcgtggcggctctgggtctggac
gcggtacccatcgaaggttttgacgccgccatcctcgatgcagaatttggtctgaaagag
aaaggctacaccagtctggtggtagttccggtgggtcatcacagcgttgaagattttaac
gctacgctgccgaaatctcgtctgccgcaaaacattaccttaaccgaagtgtaa

DBGET integrated database retrieval system