KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_0663Help
Entry
CDCO157_0663      CDS       T02122                                 

Definition
(GenBank) PhpB
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00860  Porphyrin and chlorophyll metabolism
elx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDCO157_0663
Enzymes [BR:elx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CDCO157_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PPTA
Motif
Other DBs
NCBI-ProteinID: AFJ27709
UniProt: A0A0F6C0F3
Structure
PDB: 

Position
complement(751665..752276)
Genome map
AA seq 203 aa AA seqDB search
MRLWLIRHGETQANVDGLYSGHAPTPLTARGIEQAQNLHTLLDDVSFDLVLCSELERAQH
TARLVLSDRQLPVHIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEG
FQAFSQRVERFIARLSEYQHYQNILIVSHQGVLSLLIARLIGMPAESMWHFRVDQGCWSA
IDINQKFATLRVLNSRAIGVENA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtggttaattcgtcatggcgaaacacaagcgaatgtcgatggtctgtacagc
ggtcatgcgcccacacccctgaccgcacgcggtattgagcaagcgcaaaatctgcataca
ctgctagatgatgtttcctttgacctggttttatgcagtgaactggaacgggcacagcat
accgcgcgactggttctcagtgaccgccagctccccgttcatatcatccctgaactcaac
gaaatgttttttggcgactgggagatgcgacatcatcgcgacctcatgcaagaagatgcc
gaaaactatagcgcgtggtgcaatgactggcagcatgctatccccacgaacggtgaagga
tttcaggcattttcgcaacgtgtggaacgctttatcgcaaggcttagtgaatatcagcac
tatcagaatattttaatcgtcagccatcagggcgtacttagtctgttaattgctcgttta
attggcatgcctgccgagtctatgtggcattttcgcgttgaccaggggtgttggagcgcc
attgatataaaccaaaaattcgcgacgctacgcgtcctcaatagccgtgccatcggggtc
gagaatgcatga

DBGET integrated database retrieval system