KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_2160Help
Entry
CDCO157_2160      CDS       T02122                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    CDCO157_2160
Enzymes [BR:elx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     CDCO157_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N THF_DHG_CYH_C MccV
Motif
Other DBs
NCBI-ProteinID: AFJ29215
UniProt: A0A0F6C4Q9
Structure
PDB: 

Position
complement(2247730..2248497)
Genome map
AA seq 255 aa AA seqDB search
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGG
QAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVF
SFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEK
NIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVS
GQILTVSGGGVQELN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaattctgacaacctgagactcgacggaaaatgcgccatcatcacaggtgcgggt
gcaggtattggtaaagaaatcgccattacattcgcgacagctggcgcatctgtggtggtc
agtgatattaacgccgacgcagctaaccatgttgtagacgaaattcaacaactgggtggt
caggcatttgcctgccgttgtgatattacttccgaacaggaactctctgcactggcagac
tttgctatcagtaagctgggtaaagttgatattctggttaacaacgccggtggcggtgga
cctaaaccgtttgatatgccaatggcggattttcgccgtgcttatgaactgaatgtgttt
tcttttttccatctgtcacaacttgttgcgccagaaatggaaaaaaatggcggtggcgtt
attctgaccatcacttctatggcggcagaaaataaaaatataaacatgacttcctatgca
tcatctaaagctgcggccagtcatctggtcagaaatatggcatttgacctgggtgaaaaa
aatattcgggtgaatggcattgcgccgggggcaatattaaccgatgccctgaaatccgtt
attacaccagaaattgaacaaaaaatgttacagcacacgccgatcagacgtctgggccaa
ccgcaagatattgctaacgcagcgctgttcctttgctcgcctgcagccagctgggtaagc
ggacaaattctcaccgtctccggtggtggggtacaggagctcaattaa

DBGET integrated database retrieval system