KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3007Help
Entry
CDCO157_3007      CDS       T02122                                 

Definition
(GenBank) sucrose-6 phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00052  Galactose metabolism
elx00500  Starch and sucrose metabolism
elx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CDCO157_3007
   00500 Starch and sucrose metabolism
    CDCO157_3007
Enzymes [BR:elx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CDCO157_3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AFJ30066
UniProt: A0A0F6C760
Position
3132417..3133850
Genome map
AA seq 477 aa AA seqDB search
MTQSRLHAAQNALAKLHERRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHHPMS
EHWGPMHWGHATSDDMIHWQHEPIALAPGDENDKDGCFSGSAVDDNGVLSLIYTGHVWLD
GAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGAKDP
GNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNAEGY
SYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFVAKDGRRIVIGWMDMWES
PMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSISPRTISNKYVLQENAQ
AVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLPQRD
TLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVVQHGALWQLG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatctcgattgcatgcggcgcaaaacgcactagcaaaacttcacgagcgccga
ggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatgaacgatcca
aacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcacccaatgagt
gaacactgggggccaatgcactggggacatgccaccagcgacgatatgatccactggcag
catgagcctattgcgctagcgccaggagacgagaatgacaaagatgggtgtttttcaggt
agtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtctggctcgat
ggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagtcgggatggt
attcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatgcacttccgc
gatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcgaaagaccca
ggcaacactgggcagatcctgctttatcgcggcagttcattacgtgaatggactttcgat
cgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccggactttttc
agccttggcgatcagcattatctgatgttttccccgcagggaatgaatgccgagggatac
agttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgccaggacgactt
tttgcacaatccgggcattttactgaacttgataacgggcatgacttttatgcaccacaa
agctttgtagcgaaggatggtcggcgtattgttatcggctggatggatatgtgggaatcg
ccaatgccctcaaaacgtgaaggctgggcaggctgcatgacgctggcgcgcgagctatca
gagagcaatggcaaacttctacaacgcccggtacacgaagctgagtcgttacgccagcag
catcaatctatctctccccgcacaatcagcaataaatatgttttgcaggaaaacgcgcaa
gcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacattacggatta
cagctcggcactggaatgcggctgtatattgataaccaatctgagcgacttgttttgtgg
cggtattacccacacgagaatttagacggctaccgtagtattcccctcccgcagcgtgac
acgctcgccctaaggatatttatcgatacatcatccgtggaagtatttattaacgacggg
gaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactgtcgctttat
gcctcccacggagtggctgtggtgcaacatggagcactctggcaactgggttaa

DBGET integrated database retrieval system