KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3456Help
Entry
CDCO157_3456      CDS       T02122                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00071  Fatty acid degradation
elx00280  Valine, leucine and isoleucine degradation
elx00310  Lysine degradation
elx00362  Benzoate degradation
elx00380  Tryptophan metabolism
elx00620  Pyruvate metabolism
elx00630  Glyoxylate and dicarboxylate metabolism
elx00640  Propanoate metabolism
elx00650  Butanoate metabolism
elx00900  Terpenoid backbone biosynthesis
elx01100  Metabolic pathways
elx01110  Biosynthesis of secondary metabolites
elx01120  Microbial metabolism in diverse environments
elx01130  Biosynthesis of antibiotics
elx01200  Carbon metabolism
elx01212  Fatty acid metabolism
elx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDCO157_3456
   00630 Glyoxylate and dicarboxylate metabolism
    CDCO157_3456
   00640 Propanoate metabolism
    CDCO157_3456
   00650 Butanoate metabolism
    CDCO157_3456
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDCO157_3456
   00072 Synthesis and degradation of ketone bodies
    CDCO157_3456
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDCO157_3456
   00310 Lysine degradation
    CDCO157_3456
   00380 Tryptophan metabolism
    CDCO157_3456
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDCO157_3456
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDCO157_3456
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDCO157_3456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elx04147]
    CDCO157_3456
Enzymes [BR:elx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDCO157_3456
Exosome [BR:elx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDCO157_3456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AFJ30513
UniProt: A0A0F6C8F7
Position
complement(3634262..3635443)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMTQSNGQTLVVDTDEQPHTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgcggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtctgcctaatagcgtttct
gcaatcacgattaatgacgtctgcggttccgggcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagctggtt
gacagtcttgtgcatgatgggttatgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcaattgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgacccaaagtaacggtcagacgttggttgttgataccgatgaacagccacac
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgacagcgggtaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgttgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaaggactggcaacgctttgtatcggc
gggggccagggtgtggcattgaccattgaacgtgacgaatag

DBGET integrated database retrieval system