KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3492
Entry
CDCO157_3492      CDS       T02122                                 

Definition
(GenBank) xanthine dehydrogenase subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00230  Purine metabolism
elx01100  Metabolic pathways
elx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CDCO157_3492
Enzymes [BR:elx01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CDCO157_3492
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AFJ30549
Position
3666126..3668384
AA seq 752 aa
MRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
DVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSI
EWEELPVITTPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAADYQVQGHYQTPVIQ
HCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKTFVGGGFGNK
QDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLD
VLSNTGAYVSHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFA
VESMLDDAATALGIDPVEIRLRNASREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRR
AECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINVQSGATEIGQGADT
VFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIA
HAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTT
NPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEE
MIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAI
RNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcgcgttgatgccattgctaaggtcaccgggcgggcacgatatactgacgattatgtt
atggcgggcatgtgttatgcgaaatatgtacgtagccctatcgcacatggttatgccgta
agtattaatgatgaacaagccagaagtttaccaggcgtactggcgatttttacctgggaa
gatgtgcctgatatcccattcgctacagctgggcatgcatggacacttgacgaaaacaag
cgcgataccgccgatcgcgcactgctaactcgccatgttcgtcatcatggtgacgccgtt
gccatcgtcgtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcatt
gagtgggaagaattacccgttatcaccacgccagaagcggcgctggcagaggacgctgca
ccaatccataacggcggcaatttactgaaacaaagcacgatgtcgacgggcaatgtccaa
caaacaatcgatgccgccgactaccaggtacaggggcactatcagacccccgttattcaa
cattgtcacatggaaagcgtaacatcgctggcgtggatggaggatgactcgcgaattacc
atcgtttccagcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggat
attccctggtcatgcgtacgagtcatcaaaacatttgtcggtggcggttttggtaataaa
caggatgtactggaagagccaatggcggcattcctgaccagcaagcttggcggcattccg
gtgaaagtttcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgctttt
actattgacgggcaaatgggcgtgaaccgcgacggaacattgaaaggttatagtctggat
gttctgtctaacaccggcgcttatgtatctcacgggcactccatcgcttctgcaggggga
aataaagtcgcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctat
accaacctcccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgcc
gttgagtctatgcttgatgacgccgcgacagcgttaggtattgatcctgttgaaattcgt
ttacgcaacgcctcacgcgaaggagatgctaatccgctcacgggcaaacgtatttacagc
gcagggttgccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgt
gcagagtgccagaaccagcaaggcaatttacgccgcggcgttggcgtcgcctgttttagc
tacacctctaacacctggcctgtcggcgtagaaatagcaggcgcgcgccttctgatgaat
caggatggaaccatcaacgtgcaaagcggcgcgacggaaatcggtcagggtgccgacacc
gtcttctcgcaaatggtggcagaaaccgtgggggttccggtcagcgacgttcgcgttatt
tcaacacaagataccgacgttacgccgttcgatcccggcgcatttgcctcacgccagagc
tatgttgccgcgcctgcgctgcgcagtgcggcactgttattaaaagagaaaatcatcgct
cacgccgcagtcatgctacatcagtcagcgatgaatctgaccctgataaaaggccatatc
gtgctggttgaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggacgct
ttctaccaccctgaacgcggcgggcagctctctgctgaaagctccatcaaaaccaccact
aacccaccggcgttcggctgtacctttgttgatctgacggtcgatattgcgctgtgcaaa
gtcaccatcaaccgcatcctcaacgttcatgattcgggccatattcttaatccgctactg
gcagaaggtcaggtacacggcggaatgggaatgggcattggctgggcgctatttgaagag
atgatcatcgatgcgaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatg
ccgaccatgccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaa
tccgcatacggacataagtcactgggtgagccaccaataattcctgttgccgctgctatt
cgtaacgcggtgaagatggctaccggtgttgcaatcaatacactgccgctgacgccaaaa
cggttatatgaagagttccatctggcaggattgatttga

DBGET integrated database retrieval system