KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3494
Entry
CDCO157_3494      CDS       T02122                                 

Definition
(GenBank) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00230  Purine metabolism
elx01100  Metabolic pathways
elx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CDCO157_3494
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AFJ30551
Position
3669270..3669749
AA seq 159 aa
MNHSETITIECTINGMPFQLHAVPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
catgccgtaccaggcacgccgctctcggaattactccgcgaacaagggctgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system